(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE469

MICSR_1.PE469        Location/Qualifiers
FT   CDS             931171..>931938
FT                   /codon_start=1
FT                   /gene_family="HOG000161443" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637387"
FT                   /orf_name="MICPUN_72034"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO61829.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG735081"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199AC4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z6"
FT                   /transl_table=1
FT                   /translation="MSNVYQLEPPTEGKVLLTTSHGEIEVELWAKEAPKACRNFVQLCM
FT                   EGYYDGCIFHRIIKDFMIQTGDPTGTGRGGESIYGEYFKDELHSRIKFNHRGQVAMANA
FT                   GGRDTNGSQFFITLERTDWIDRKHTIFGKVTGHTIYNALQIADLEVDGDRPVEPYPKIL
FT                   KTEIVWNPFEDIVPRVMKKLDGDVDDEEAGDTRKKKKKEKKKLNLLSFGEEAGEEEEEL
FT                   AKMAKPKVKSVFDADAAENDGRIAKPGSAEEAAA"
     MSNVYQLEPP TEGKVLLTTS HGEIEVELWA KEAPKACRNF VQLCMEGYYD GCIFHRIIKD        60
     FMIQTGDPTG TGRGGESIYG EYFKDELHSR IKFNHRGQVA MANAGGRDTN GSQFFITLER       120
     TDWIDRKHTI FGKVTGHTIY NALQIADLEV DGDRPVEPYP KILKTEIVWN PFEDIVPRVM       180
     KKLDGDVDDE EAGDTRKKKK KEKKKLNLLS FGEEAGEEEE ELAKMAKPKV KSVFDADAAE       240
     NDGRIAKPGS AEEAAA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page