(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE47

MICSR_1.PE47         Location/Qualifiers
FT   CDS             complement(91903..96459)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636052"
FT                   /orf_name="MICPUN_56620"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62053.1"
FT                   /db_xref="UniParc:UPI000199ABA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S4"
FT                   /transl_table=1
FT                   /translation="MPPPRGRGASPFGDPFTFGKPLVLNSQPPTFFGSSLAPPADASAS
FT                   DAPMGGGAVTRSRSARRKVGGYGVTAPAKHGPKDTFTRTTGTDAPSPITGDDRDRPARR
FT                   VAPRVVTKIPVLDDWEPAEDENEDPSVIPPHVDDVPASAAATKAARGRNPARTAETARG
FT                   PAPRRPPPVSSRTTRTTTTKRPASANLREEDERGRNDAAAVVIAARARAKARLAPPRVA
FT                   FGGRPPKKPSPVKRQRHDPDQPPPPDDQQTAADVDVVPRPKPGFSFGVRPNRGGPSLWG
FT                   PGKDSPGPAAYHEGPAPECDQVRGHVPAVTFGAPPDRTRRSGAGWNAGAFPELDPDAPG
FT                   PGEYAGGDDTARVLDKIAGKSRAPAFTFGGGKDDIGKVAAKDFAGAPGPGAYHIDEILA
FT                   VAAERRRIEKGFSFGERVGAAWHEAGPGRDAPAPGTYADGTEVRRSGGGFSFGNAPKTP
FT                   SFIPSSKDGPTPGPGDYLDRKKEKENGGGENDGGDGRTRKSAEGGFTFGWRRPDPAKSA
FT                   TEPGPGAYHRDAQLDDPEALRPGPAFSLGTKLERGGALDGKKDAAKMPGPGDYEVRKSA
FT                   EAGPSYTIFGRPNDGVVVGVDLNEKASLPGPGRYHTPLSPGGRAYTLGSRIEEKDAKRD
FT                   TPAPGEYGAPMPVGAQWGDRNRGFSVLGRDAWAGKGWGEEHAEVPGVGRYDVRGSNSKP
FT                   LPSAPAFTMAGKTKDPTHAPPPTRDIGPGEYDGDGGNRPPSGPSFTIGVRGSKDGAYGD
FT                   LESAAEKPGPGAYPNAPKAKDETRESAPSFTLGRKIDVPDERTKVGPTGFSERPGPGEY
FT                   HADGDVVPPEGPGGFTIYERTKSTEFRPGVDSPGPAYYGGFTTDDVEGGLRMSIHERYE
FT                   SGSVFQHTDRSDTPGPGEYAPEVFQFPVRDDGESTSFVGAPPGYTIGVRRESNYPVRRS
FT                   QIGAPGPGEYHPTEGDGVTDPAWSKGVTIGERRDERARRSLDSRPGPGHYHRTRESIER
FT                   ETGRKAPVPGPKIRDRKPWEREKVLEKKADVPGPSDYDTEPSMKKMDKRAPAHRIGERR
FT                   NDAADRRGSGEGAPGPGEYAGDVVRAPDWRRGATIIADRRERSRASAERRPGPGEYHRD
FT                   APRVAKTGVNIGRGAGKDAPGGVFDAAGRGGPGPGEFEPPPGAIRPGRSTGVNIARGTG
FT                   KDAPGGVFERAGRDVPGPGEHWPDGDAASGRGGRSGGKSVRAPGVKIPATGHDAPGGAA
FT                   VWPEDAPGPGEYHEERTKPVRSAVNIGKASGKDAPGGVFDAALKRGGGPGPGEFESGPG
FT                   ALRQKSTAVNMGKGTGREAPGGAMDRRDGPGPGEFWPDEDPAAPTRGHTQRGIPFGKPP
FT                   KPPRPGAKKSSAPGPGEYAGSVVGAPDARVGPTIPRGKRRGLVSKDARDTPAPGDFEPD
FT                   HHPKTVAGLVREALKRPGSMREPTVPRGGKKAGSERTPGPGEYYSGRGEIRVDRGVKMP
FT                   TREAWERDRDRVKGSGLGPKYHPNHEKVSKPLSVKQPMARADDYADSFRSTRGGSRR"
     MPPPRGRGAS PFGDPFTFGK PLVLNSQPPT FFGSSLAPPA DASASDAPMG GGAVTRSRSA        60
     RRKVGGYGVT APAKHGPKDT FTRTTGTDAP SPITGDDRDR PARRVAPRVV TKIPVLDDWE       120
     PAEDENEDPS VIPPHVDDVP ASAAATKAAR GRNPARTAET ARGPAPRRPP PVSSRTTRTT       180
     TTKRPASANL REEDERGRND AAAVVIAARA RAKARLAPPR VAFGGRPPKK PSPVKRQRHD       240
     PDQPPPPDDQ QTAADVDVVP RPKPGFSFGV RPNRGGPSLW GPGKDSPGPA AYHEGPAPEC       300
     DQVRGHVPAV TFGAPPDRTR RSGAGWNAGA FPELDPDAPG PGEYAGGDDT ARVLDKIAGK       360
     SRAPAFTFGG GKDDIGKVAA KDFAGAPGPG AYHIDEILAV AAERRRIEKG FSFGERVGAA       420
     WHEAGPGRDA PAPGTYADGT EVRRSGGGFS FGNAPKTPSF IPSSKDGPTP GPGDYLDRKK       480
     EKENGGGEND GGDGRTRKSA EGGFTFGWRR PDPAKSATEP GPGAYHRDAQ LDDPEALRPG       540
     PAFSLGTKLE RGGALDGKKD AAKMPGPGDY EVRKSAEAGP SYTIFGRPND GVVVGVDLNE       600
     KASLPGPGRY HTPLSPGGRA YTLGSRIEEK DAKRDTPAPG EYGAPMPVGA QWGDRNRGFS       660
     VLGRDAWAGK GWGEEHAEVP GVGRYDVRGS NSKPLPSAPA FTMAGKTKDP THAPPPTRDI       720
     GPGEYDGDGG NRPPSGPSFT IGVRGSKDGA YGDLESAAEK PGPGAYPNAP KAKDETRESA       780
     PSFTLGRKID VPDERTKVGP TGFSERPGPG EYHADGDVVP PEGPGGFTIY ERTKSTEFRP       840
     GVDSPGPAYY GGFTTDDVEG GLRMSIHERY ESGSVFQHTD RSDTPGPGEY APEVFQFPVR       900
     DDGESTSFVG APPGYTIGVR RESNYPVRRS QIGAPGPGEY HPTEGDGVTD PAWSKGVTIG       960
     ERRDERARRS LDSRPGPGHY HRTRESIERE TGRKAPVPGP KIRDRKPWER EKVLEKKADV      1020
     PGPSDYDTEP SMKKMDKRAP AHRIGERRND AADRRGSGEG APGPGEYAGD VVRAPDWRRG      1080
     ATIIADRRER SRASAERRPG PGEYHRDAPR VAKTGVNIGR GAGKDAPGGV FDAAGRGGPG      1140
     PGEFEPPPGA IRPGRSTGVN IARGTGKDAP GGVFERAGRD VPGPGEHWPD GDAASGRGGR      1200
     SGGKSVRAPG VKIPATGHDA PGGAAVWPED APGPGEYHEE RTKPVRSAVN IGKASGKDAP      1260
     GGVFDAALKR GGGPGPGEFE SGPGALRQKS TAVNMGKGTG REAPGGAMDR RDGPGPGEFW      1320
     PDEDPAAPTR GHTQRGIPFG KPPKPPRPGA KKSSAPGPGE YAGSVVGAPD ARVGPTIPRG      1380
     KRRGLVSKDA RDTPAPGDFE PDHHPKTVAG LVREALKRPG SMREPTVPRG GKKAGSERTP      1440
     GPGEYYSGRG EIRVDRGVKM PTREAWERDR DRVKGSGLGP KYHPNHEKVS KPLSVKQPMA      1500
     RADDYADSFR STRGGSRR                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page