(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE470

MICSR_1.PE470        Location/Qualifiers
FT   CDS             join(933660..933891,934045..936116)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637388"
FT                   /orf_name="MICPUN_57054"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61830.1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199ACBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z7"
FT                   /transl_table=1
FT                   /translation="MSNGWGVLVAKCDKSRSAKHLDRSVDRSGDVTSEPFREQPDIELR
FT                   LTKTIVGRMLMNAEGTSRAQTQVADILIDMPSVSAKHCVITCDEPEGSDTYVITVTDHS
FT                   RHGVQVNKKKISGPTTLSHGDVLTLPFGMDYEFLVLDDGAKPMAPKPAEPKSAKKTPGK
FT                   RAKSVGKASAGKKKGASEDDDAAAKRAKSGDDDSPSATKKLFADDTNALEEAKQLEDAN
FT                   AKLRDELKAAKETIEERDRTIAEHIESAETTKAQYEEALAAAAKEHKAKLAELTADAKS
FT                   HDANVAAMSASCEAAIKSKEEMQAALDRAVAAREGAEKNAAETAAALEEVKAALKDAEA
FT                   AAAAAAEKAAEGSKELEAENASLRAKLEEERTTTAEKAAEIREAREKLEATEADLAVAK
FT                   NDADQLAIKLAEAKASLAAAVKRADEADTCAAPLRASENEARRVCARKEEEAKAMADRL
FT                   AVARMAHKQAMAALKEVGLRLEYDGTGAAAAEADAEATEAEPNTEPPTMDDGAEDAPMD
FT                   ADGVAGATQAAPGDFETEDAIDEEPRETENEGDRIVGMDVLYASVPASEVPASDVPSSM
FT                   DDGSEDEPVPDTELAAPAEGASPVAAMAPPSPREQPESAARHSVGAATQEAAAVLGGGE
FT                   LGGAPAEEEGEEEKEEKEEEAEDVSSGSDAEEKGSESEDTEEVEEEEPEAAGNAVEEPE
FT                   AEEPEADEPEADEPEAEEPEAEEPVEPALVAKVAVPEEEKENSAPVDASVGKELPFSSE
FT                   VEDVAAVPLSFLED"
     MSNGWGVLVA KCDKSRSAKH LDRSVDRSGD VTSEPFREQP DIELRLTKTI VGRMLMNAEG        60
     TSRAQTQVAD ILIDMPSVSA KHCVITCDEP EGSDTYVITV TDHSRHGVQV NKKKISGPTT       120
     LSHGDVLTLP FGMDYEFLVL DDGAKPMAPK PAEPKSAKKT PGKRAKSVGK ASAGKKKGAS       180
     EDDDAAAKRA KSGDDDSPSA TKKLFADDTN ALEEAKQLED ANAKLRDELK AAKETIEERD       240
     RTIAEHIESA ETTKAQYEEA LAAAAKEHKA KLAELTADAK SHDANVAAMS ASCEAAIKSK       300
     EEMQAALDRA VAAREGAEKN AAETAAALEE VKAALKDAEA AAAAAAEKAA EGSKELEAEN       360
     ASLRAKLEEE RTTTAEKAAE IREAREKLEA TEADLAVAKN DADQLAIKLA EAKASLAAAV       420
     KRADEADTCA APLRASENEA RRVCARKEEE AKAMADRLAV ARMAHKQAMA ALKEVGLRLE       480
     YDGTGAAAAE ADAEATEAEP NTEPPTMDDG AEDAPMDADG VAGATQAAPG DFETEDAIDE       540
     EPRETENEGD RIVGMDVLYA SVPASEVPAS DVPSSMDDGS EDEPVPDTEL AAPAEGASPV       600
     AAMAPPSPRE QPESAARHSV GAATQEAAAV LGGGELGGAP AEEEGEEEKE EKEEEAEDVS       660
     SGSDAEEKGS ESEDTEEVEE EEPEAAGNAV EEPEAEEPEA DEPEADEPEA EEPEAEEPVE       720
     PALVAKVAVP EEEKENSAPV DASVGKELPF SSEVEDVAAV PLSFLED                     767
//

If you have problems or comments...

PBIL Back to PBIL home page