(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE471

MICSR_1.PE471        Location/Qualifiers
FT   CDS             936488..938596
FT                   /codon_start=1
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637389"
FT                   /orf_name="MICPUN_93714"
FT                   /product="Predicted protein"
FT                   /function="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) activity"
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61831.1"
FT                   /db_xref="GO:0004360"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="HOGENOM:HBG645312"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI000199ACBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z8"
FT                   /transl_table=1
FT                   /translation="MCGIFAYVNYGVPTKQKAIVDKLLNGLRRLEYRGYDSAGIAIDNG
FT                   PSLDELSPIVLKETGKIDMLADFITNKENLNSDLFFENHCGIGHTRWATHGPPAPRNSH
FT                   PHTSDANNEFLVVHNGIITNHQALREMLERKGFVFESETDTEVIPKLTKYLYEKFHNRV
FT                   TFRQLVMEVVRQLQGAFALIFKSSHYPGELVAAKRGSPLLLGIVEEPGKNAPHAVLTSE
FT                   GFKTSKEGPIGDEAPRDNGGKRQKTLKNHVEYYFASDASAMVEHTKRVLHLEDDDVAHL
FT                   HNGGYGIYRMERSKPTSGTSSPVHYEPTVQSAEVERTVETLQMEVEQIMKGSFKHFMQK
FT                   EIHEQPESMVQTMRGRMVTCDEGKTAERVFLGGMVNFVSTIRRSRRIILCGCGTSYNSA
FT                   IAVRQLMEELTELPVTLELASDVLDRQCPFFRDDTCVFISQSGETADTLKAMQYAKERG
FT                   ALCVGIVNTVGSAISRSTDCGVHINAGAEIGVASTKAYTCQIVAMVLLALALSEDSISR
FT                   ATRRKEIMQSLLGLPEAVRTALKLDAQMLALAEALKDEQSLLLFGRGYNYATALEGALK
FT                   VKEVALLHSEGILAGEMKHGPLALVDETMPLVVVATRDGSYAKQESVVQQLRARGGRLI
FT                   LIATEGDDQIAEVAGKDATIIWVPEVEDCLQAVVNIVPLQLLSYHLTVLRGHNVDQPRN
FT                   LAKSVTVE"
     MCGIFAYVNY GVPTKQKAIV DKLLNGLRRL EYRGYDSAGI AIDNGPSLDE LSPIVLKETG        60
     KIDMLADFIT NKENLNSDLF FENHCGIGHT RWATHGPPAP RNSHPHTSDA NNEFLVVHNG       120
     IITNHQALRE MLERKGFVFE SETDTEVIPK LTKYLYEKFH NRVTFRQLVM EVVRQLQGAF       180
     ALIFKSSHYP GELVAAKRGS PLLLGIVEEP GKNAPHAVLT SEGFKTSKEG PIGDEAPRDN       240
     GGKRQKTLKN HVEYYFASDA SAMVEHTKRV LHLEDDDVAH LHNGGYGIYR MERSKPTSGT       300
     SSPVHYEPTV QSAEVERTVE TLQMEVEQIM KGSFKHFMQK EIHEQPESMV QTMRGRMVTC       360
     DEGKTAERVF LGGMVNFVST IRRSRRIILC GCGTSYNSAI AVRQLMEELT ELPVTLELAS       420
     DVLDRQCPFF RDDTCVFISQ SGETADTLKA MQYAKERGAL CVGIVNTVGS AISRSTDCGV       480
     HINAGAEIGV ASTKAYTCQI VAMVLLALAL SEDSISRATR RKEIMQSLLG LPEAVRTALK       540
     LDAQMLALAE ALKDEQSLLL FGRGYNYATA LEGALKVKEV ALLHSEGILA GEMKHGPLAL       600
     VDETMPLVVV ATRDGSYAKQ ESVVQQLRAR GGRLILIATE GDDQIAEVAG KDATIIWVPE       660
     VEDCLQAVVN IVPLQLLSYH LTVLRGHNVD QPRNLAKSVT VE                          702
//

If you have problems or comments...

PBIL Back to PBIL home page