(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE472

MICSR_1.PE472        Location/Qualifiers
FT   CDS             join(938732..940451,940473..940930)
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637390"
FT                   /orf_name="MICPUN_97165"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61832.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199ACBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z9"
FT                   /transl_table=1
FT                   /translation="MAFWKPGSKKPEASLPLSAEVDREGPGDSGGRLVVFNRNENLALQ
FT                   AQRERLPIFKTRDAILHLVETRATTVLVGQTGCGKTTQVPQYLVEAGWTAGGRLVACTQ
FT                   PRRVAAMTVASRVADEMGVTLGAEVGYAVRFENVSTPGVTRVRFCTDGVLLRELMEDPL
FT                   LSRYSVVMVDEAHERSLATDLLLGLLKKVQRRRPDLRIIIASATIQAEEFAAFFDTRHL
FT                   EPKPASEASSVNAPSREPGIVSVEGRAHTVLIHYLEKPVPDYVKAAVGAAIDVHRAEGP
FT                   GDVLVFLTGEEEIEAAVSMLQEEAEDNSRRLLGGGAGTNPAGGPERFTVHPLYAGLSPA
FT                   QQMEAFRPAPRYTRKIVVASNVAETSVTIEGVVYVVDCCFVKQKAYDPTRGMESLLTAE
FT                   ASRASANQRAGRAGRVRPGKAYRLCTEKAFRDLPETAPPEMIRSDLAATVLQLKALGID
FT                   NIMNFEWLSPPPAANMIKALELLYALQAIDDDARLTKPLGMHLAELPLEPQLGKALLVS
FT                   GELGCVEEMLTVSAYLQVQTLWVSPRGRQKRLDECRDRFAVAEGDAVTALNIHTAWCGG
FT                   RARSFADKNMLSHRALVRASDIRAQLARHVRRVGLVVSSAGKDSAPVRRAMTAGFFANA
FT                   AALAPHGGGAEGSAFRSVRGGATLFIHPGSVLFRARPAMVVYAAAVRTGREYMRDVTAI
FT                   DPEWLSELAPHFYAMTQRSGNERPADAAAVF"
     MAFWKPGSKK PEASLPLSAE VDREGPGDSG GRLVVFNRNE NLALQAQRER LPIFKTRDAI        60
     LHLVETRATT VLVGQTGCGK TTQVPQYLVE AGWTAGGRLV ACTQPRRVAA MTVASRVADE       120
     MGVTLGAEVG YAVRFENVST PGVTRVRFCT DGVLLRELME DPLLSRYSVV MVDEAHERSL       180
     ATDLLLGLLK KVQRRRPDLR IIIASATIQA EEFAAFFDTR HLEPKPASEA SSVNAPSREP       240
     GIVSVEGRAH TVLIHYLEKP VPDYVKAAVG AAIDVHRAEG PGDVLVFLTG EEEIEAAVSM       300
     LQEEAEDNSR RLLGGGAGTN PAGGPERFTV HPLYAGLSPA QQMEAFRPAP RYTRKIVVAS       360
     NVAETSVTIE GVVYVVDCCF VKQKAYDPTR GMESLLTAEA SRASANQRAG RAGRVRPGKA       420
     YRLCTEKAFR DLPETAPPEM IRSDLAATVL QLKALGIDNI MNFEWLSPPP AANMIKALEL       480
     LYALQAIDDD ARLTKPLGMH LAELPLEPQL GKALLVSGEL GCVEEMLTVS AYLQVQTLWV       540
     SPRGRQKRLD ECRDRFAVAE GDAVTALNIH TAWCGGRARS FADKNMLSHR ALVRASDIRA       600
     QLARHVRRVG LVVSSAGKDS APVRRAMTAG FFANAAALAP HGGGAEGSAF RSVRGGATLF       660
     IHPGSVLFRA RPAMVVYAAA VRTGREYMRD VTAIDPEWLS ELAPHFYAMT QRSGNERPAD       720
     AAAVF                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page