(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE474

MICSR_1.PE474        Location/Qualifiers
FT   CDS             complement(944680..945765)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637392"
FT                   /orf_name="MICPUN_107932"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="ACO62253.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI000199ACBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E201"
FT                   /transl_table=1
FT                   /translation="MLRRLQKSLAGNCPVGTPITPLPANGGDGAHEGKAHVHIIAVEPV
FT                   YSAMDDDASNSHPNSPANSPKAAKFSGGAVGGEEFPVASAFVFDAPFVPQGAPKPSGPE
FT                   AALRITWRCRTTARVDGKFPGLCARLLVTDESTTEMSPASSAAEMLRAQSRAIAAAATA
FT                   WDELRNGATSSAVVGVVGGVSANAAAVDDAASAAAVAGCLGALQRSLQGSLAAGVNGGV
FT                   PAICRAFFPEEESRKRAMSDQSSQTPEIDEEDEESDNTKQEEAVTGSPKPQVDPRAMTS
FT                   EDRSGLLAALEDFLSACARAVEVHGTATRLTAAGKPRGESGASTIEQMQGMFVRCLAEI
FT                   RRDITVISDREKDVDNDEEYK"
     MLRRLQKSLA GNCPVGTPIT PLPANGGDGA HEGKAHVHII AVEPVYSAMD DDASNSHPNS        60
     PANSPKAAKF SGGAVGGEEF PVASAFVFDA PFVPQGAPKP SGPEAALRIT WRCRTTARVD       120
     GKFPGLCARL LVTDESTTEM SPASSAAEML RAQSRAIAAA ATAWDELRNG ATSSAVVGVV       180
     GGVSANAAAV DDAASAAAVA GCLGALQRSL QGSLAAGVNG GVPAICRAFF PEEESRKRAM       240
     SDQSSQTPEI DEEDEESDNT KQEEAVTGSP KPQVDPRAMT SEDRSGLLAA LEDFLSACAR       300
     AVEVHGTATR LTAAGKPRGE SGASTIEQMQ GMFVRCLAEI RRDITVISDR EKDVDNDEEY       360
     K                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page