(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE478

MICSR_1.PE478        Location/Qualifiers
FT   CDS             960347..962326
FT                   /codon_start=1
FT                   /gene_family="HOG000265335" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637396"
FT                   /orf_name="MICPUN_99546"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO61836.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG560238"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199ACC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E205"
FT                   /transl_table=1
FT                   /translation="MQEVDPSKQDHPKWMRDMWSEKVQAVDKNVIDKELEARLESRPPE
FT                   LDHVQPGEELFVTFGTASVTDFVQNWLESADKLGLSPLFVGALDEDMYEWCKKRGVPSM
FT                   LLKGNTVLKNRGQQFITAGDKSFKKMGTVKTKFIQDLLELGIAPILTDADVVWLKDPRS
FT                   YFKRGTYITADVLVSTDCIDVPADRKDNNGCSHVNFNTGVLHFRPTDAAKAFVQTWKTK
FT                   VATSTIAWMRDQPAFNLITHEGVGGHSLEPAVSVPEERRGTEGHRMVYWAANASIRLGV
FT                   LPNWLFGNGHSYFVQWHHLTHPEDGEPFSVHLTYQYGDTGSYAFGKRERMRQAGIWRSD
FT                   PREYFEDGKYLVVSDEGSQVDFSGESPGGEEVGSDRNAYRTAIDRHLREDKLRRTTIRN
FT                   ALALARALNRILVLPEARCYCDKIWNNLNACRAPGAESFKLPYACPMDHIYDLPSWFNP
FT                   GMPDFREPGFLDDPRVPDAIKASVGRVVVDRDGDTRAGKPGWDMNDGKVVKLRHGFTVP
FT                   DAKLALKSLEEKRVIEVDFLGNEGTFCGFGDDAKNKEFDRIVVKPLSASQYYCFTELWE
FT                   DQGSPRGGRNGPYEPQVVLRHCGMMEDDFKRAGKVHAGVVEHIDKPDGGCSCEWGFGLP
FT                   RGLAHISKDESICPRRNSDQPTAG"
     MQEVDPSKQD HPKWMRDMWS EKVQAVDKNV IDKELEARLE SRPPELDHVQ PGEELFVTFG        60
     TASVTDFVQN WLESADKLGL SPLFVGALDE DMYEWCKKRG VPSMLLKGNT VLKNRGQQFI       120
     TAGDKSFKKM GTVKTKFIQD LLELGIAPIL TDADVVWLKD PRSYFKRGTY ITADVLVSTD       180
     CIDVPADRKD NNGCSHVNFN TGVLHFRPTD AAKAFVQTWK TKVATSTIAW MRDQPAFNLI       240
     THEGVGGHSL EPAVSVPEER RGTEGHRMVY WAANASIRLG VLPNWLFGNG HSYFVQWHHL       300
     THPEDGEPFS VHLTYQYGDT GSYAFGKRER MRQAGIWRSD PREYFEDGKY LVVSDEGSQV       360
     DFSGESPGGE EVGSDRNAYR TAIDRHLRED KLRRTTIRNA LALARALNRI LVLPEARCYC       420
     DKIWNNLNAC RAPGAESFKL PYACPMDHIY DLPSWFNPGM PDFREPGFLD DPRVPDAIKA       480
     SVGRVVVDRD GDTRAGKPGW DMNDGKVVKL RHGFTVPDAK LALKSLEEKR VIEVDFLGNE       540
     GTFCGFGDDA KNKEFDRIVV KPLSASQYYC FTELWEDQGS PRGGRNGPYE PQVVLRHCGM       600
     MEDDFKRAGK VHAGVVEHID KPDGGCSCEW GFGLPRGLAH ISKDESICPR RNSDQPTAG        659
//

If you have problems or comments...

PBIL Back to PBIL home page