(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE479

MICSR_1.PE479        Location/Qualifiers
FT   CDS             complement(962413..963198)
FT                   /codon_start=1
FT                   /gene_family="HOG000264921" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637397"
FT                   /gene_name="TIC55-2"
FT                   /orf_name="MICPUN_57064"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62255.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG560239"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199ACC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E206"
FT                   /transl_table=1
FT                   /translation="MDSDAAVGPSRSGEWHVVAKSDQLARENARVQVTADGRYLVVARS
FT                   GGRLYAFDATCYHMGAPLLHGDIEDVDGHGACITCPWHHYQISMSTGERLYQDMSRKTC
FT                   TLPKKQRVHEVMEADGEVRVRLSGGGKPPSPPPDVIRPKPHEVDYEWESDRYAFKPPPP
FT                   SQASQKAPRSGKVFNRGGGRFPPGAFGRGSAGLHPGLVGAGVGREVGRMVADSMRGGDG
FT                   KAPWAMSRGFAQPPPKAKPALAGEALAEGEELPDAPGDG"
     MDSDAAVGPS RSGEWHVVAK SDQLARENAR VQVTADGRYL VVARSGGRLY AFDATCYHMG        60
     APLLHGDIED VDGHGACITC PWHHYQISMS TGERLYQDMS RKTCTLPKKQ RVHEVMEADG       120
     EVRVRLSGGG KPPSPPPDVI RPKPHEVDYE WESDRYAFKP PPPSQASQKA PRSGKVFNRG       180
     GGRFPPGAFG RGSAGLHPGL VGAGVGREVG RMVADSMRGG DGKAPWAMSR GFAQPPPKAK       240
     PALAGEALAE GEELPDAPGD G                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page