(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE48

MICSR_1.PE48         Location/Qualifiers
FT   CDS             97294..97956
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636053"
FT                   /orf_name="MICPUN_99254"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61607.1"
FT                   /db_xref="HOGENOM:HBG560240"
FT                   /db_xref="UniParc:UPI000199ABAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S5"
FT                   /transl_table=1
FT                   /translation="MAEDPYKVLGVKEGTPGDELAKVINRKKLLYKTEPEKLKQMEDAY
FT                   EQIVQASLAARLRGDMSGVSESARKNDLAPSLFGPWAPIPSEAPLKDKKVNIAISVAAV
FT                   LFVWFTPGTIRTIQPIIYATIFHAFRMFMKLVDVDPGPSANIDRDAATKHNNKRFFRAF
FT                   ALVMGTFAVSLGITYWIPNMIFETFRLQVPVWYLLNQEVFVSVIVGGCLAYLTCFYR"
     MAEDPYKVLG VKEGTPGDEL AKVINRKKLL YKTEPEKLKQ MEDAYEQIVQ ASLAARLRGD        60
     MSGVSESARK NDLAPSLFGP WAPIPSEAPL KDKKVNIAIS VAAVLFVWFT PGTIRTIQPI       120
     IYATIFHAFR MFMKLVDVDP GPSANIDRDA ATKHNNKRFF RAFALVMGTF AVSLGITYWI       180
     PNMIFETFRL QVPVWYLLNQ EVFVSVIVGG CLAYLTCFYR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page