(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE480

MICSR_1.PE480        Location/Qualifiers
FT   CDS             963441..963827
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637398"
FT                   /orf_name="MICPUN_99547"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO61837.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199A5D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E207"
FT                   /transl_table=1
FT                   /translation="MADMVQEIVVAKPVSPVQFMIDYLAVGSSLCQQDKYGLSMMRRAR
FT                   LMKIFKAWDKNQDKTVDLKELRAFTRKHGGNAVTQDELKDIFMDMDESGDSKVDEDEFL
FT                   KFFSLSVKRMDDDEFEQMIQDMLQ"
     MADMVQEIVV AKPVSPVQFM IDYLAVGSSL CQQDKYGLSM MRRARLMKIF KAWDKNQDKT        60
     VDLKELRAFT RKHGGNAVTQ DELKDIFMDM DESGDSKVDE DEFLKFFSLS VKRMDDDEFE       120
     QMIQDMLQ                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page