(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE483

MICSR_1.PE483        Location/Qualifiers
FT   CDS             complement(966003..968894)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637401"
FT                   /orf_name="MICPUN_57068"
FT                   /product="Chaperone, Hsp100 family, clpb-type "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein metabolic process "
FT                   /protein_id="ACO62257.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniParc:UPI000199A5DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E210"
FT                   /transl_table=1
FT                   /translation="MSAMASNVAGGRVVASAVRRDGNAVRSRRPPGLGEFRPSRPLRSK
FT                   VATRVSADSAKKISQNEFTERAWEAIVLAPEIASNSQQQIVETEHLCKAMFEQKDSFAL
FT                   RILTQAGVDPSAAVGFIDRFISRQPKVSGGAQQVLGRHLEALVEEARVRRSAMRDDFVA
FT                   VEHLVLAICKDERVGNALMAELGLNEDALKNAVTKLRGGTNVTDQGAEGKYESLKRYAR
FT                   DLTAEARAGKLDPVIGRDDEIRRTIQILSRRSKNNPVLIGEPGVGKTAISEGLAQRIVQ
FT                   GDVPLSLQGVQVMSLDMGLLIAGAKFRGEFEDRLKAVMKEVTDSDGGIILFIDEIHTVV
FT                   GAGGSGGSGGGMDAGNLLKPMLGRGELRCIGATTLDEYRQYIEKDPALERRFQKVLIDQ
FT                   PSVEDAISILRGLRERYEIHHGVSISDNALVEAAVLSDRYIADRFLPDKAIDLVDEAAA
FT                   KLKMEITSKPTVLDEIDREILKLQMEQLSLRRPAGSRPSEQANVSARLQRVESELASLM
FT                   VRQDTLTFQWEQEKAKLAAIQQLKEEIDAVQTEVSQAERDYDLNKAAELKYGSLMNLQR
FT                   ELLDAEAAMDAAAAQGGDLLRDEVTESDIADIISKWTGIPVSKLQEGEREKLLNLPAEL
FT                   HKRVVGQDLAVQAVTEAIQRSRAGLSDPNRPIASFMFLGPTGVGKTELAKTLATFLFNT
FT                   EEAMVRIDMSEYMEKHAVSRLIGAPPGYVGFEEGGQLTEAVRRRPYSVVLFDEMEKAHG
FT                   DVFNVLLQILDDGRVTDSQGRVVNFKNAILIMTSNIGSQFVLENMNDNSEGGKAYRRER
FT                   VMEAVRGHFRPEFVNRVDEYIVFDPLDFNQVRKIVEQQVERVRSRLKDRKIGLRVDESA
FT                   IQMLCEAGYDPSFGARPVKRAVQHLLETSLAQAILRGDVAENEQAVVWAHGEGEGRQLL
FT                   VAKEEGQRQEEPAQQELNGADPYAQMSWDQTPQ"
     MSAMASNVAG GRVVASAVRR DGNAVRSRRP PGLGEFRPSR PLRSKVATRV SADSAKKISQ        60
     NEFTERAWEA IVLAPEIASN SQQQIVETEH LCKAMFEQKD SFALRILTQA GVDPSAAVGF       120
     IDRFISRQPK VSGGAQQVLG RHLEALVEEA RVRRSAMRDD FVAVEHLVLA ICKDERVGNA       180
     LMAELGLNED ALKNAVTKLR GGTNVTDQGA EGKYESLKRY ARDLTAEARA GKLDPVIGRD       240
     DEIRRTIQIL SRRSKNNPVL IGEPGVGKTA ISEGLAQRIV QGDVPLSLQG VQVMSLDMGL       300
     LIAGAKFRGE FEDRLKAVMK EVTDSDGGII LFIDEIHTVV GAGGSGGSGG GMDAGNLLKP       360
     MLGRGELRCI GATTLDEYRQ YIEKDPALER RFQKVLIDQP SVEDAISILR GLRERYEIHH       420
     GVSISDNALV EAAVLSDRYI ADRFLPDKAI DLVDEAAAKL KMEITSKPTV LDEIDREILK       480
     LQMEQLSLRR PAGSRPSEQA NVSARLQRVE SELASLMVRQ DTLTFQWEQE KAKLAAIQQL       540
     KEEIDAVQTE VSQAERDYDL NKAAELKYGS LMNLQRELLD AEAAMDAAAA QGGDLLRDEV       600
     TESDIADIIS KWTGIPVSKL QEGEREKLLN LPAELHKRVV GQDLAVQAVT EAIQRSRAGL       660
     SDPNRPIASF MFLGPTGVGK TELAKTLATF LFNTEEAMVR IDMSEYMEKH AVSRLIGAPP       720
     GYVGFEEGGQ LTEAVRRRPY SVVLFDEMEK AHGDVFNVLL QILDDGRVTD SQGRVVNFKN       780
     AILIMTSNIG SQFVLENMND NSEGGKAYRR ERVMEAVRGH FRPEFVNRVD EYIVFDPLDF       840
     NQVRKIVEQQ VERVRSRLKD RKIGLRVDES AIQMLCEAGY DPSFGARPVK RAVQHLLETS       900
     LAQAILRGDV AENEQAVVWA HGEGEGRQLL VAKEEGQRQE EPAQQELNGA DPYAQMSWDQ       960
     TPQ                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page