(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE484

MICSR_1.PE484        Location/Qualifiers
FT   CDS             join(complement(969325..>969996),
FT                   complement(<969086..969219))
FT                   /codon_start=1
FT                   /gene_family="HOG000264974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637402"
FT                   /orf_name="MICPUN_70208"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62258.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG413464"
FT                   /db_xref="InterPro:IPR012926"
FT                   /db_xref="UniParc:UPI000199A5DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E211"
FT                   /transl_table=1
FT                   /translation="GALDGYLKPPRNGKFLSLLMGNAVDVTSQRQENRLRIKEEYYSFR
FT                   DRSTFTYVAWPTALLYLNRERQKGLEAGAANTWFSLVTVFPVLVQFYWCWMLYFYAALA
FT                   LRENVLRCNGSRIRRWWINHHYYSMGMCLVVLTMDVQSNACLNYMSRFLVFTALQGVVM
FT                   LTQNRYQRFRMYTRVAMGKASPMDVAGGEMGGNAGQLKLLYPLLFGLQIMQVYFGASVL
FT                   VSFFREWQAPAAGALFVVMGVGNFRATCQTYFTKRKFAKESSRSKA"
     GALDGYLKPP RNGKFLSLLM GNAVDVTSQR QENRLRIKEE YYSFRDRSTF TYVAWPTALL        60
     YLNRERQKGL EAGAANTWFS LVTVFPVLVQ FYWCWMLYFY AALALRENVL RCNGSRIRRW       120
     WINHHYYSMG MCLVVLTMDV QSNACLNYMS RFLVFTALQG VVMLTQNRYQ RFRMYTRVAM       180
     GKASPMDVAG GEMGGNAGQL KLLYPLLFGL QIMQVYFGAS VLVSFFREWQ APAAGALFVV       240
     MGVGNFRATC QTYFTKRKFA KESSRSKA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page