(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE485

MICSR_1.PE485        Location/Qualifiers
FT   CDS             970536..971945
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637403"
FT                   /orf_name="MICPUN_57070"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61839.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A5DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E212"
FT                   /transl_table=1
FT                   /translation="MSGFHTEDGYNGPSLFGQNGAIVGGVRNKLGHVASEEEKQQARRT
FT                   VVVIGIKWLLSPGWRGDDYRDAVFPAEVAQWFEEQIGPVQAVHFKPPVQAWVEFNSASN
FT                   ATAALNLNGATYPRKCKHSPGGRIKVSRATHTELVRGAKDHLRSYHVLIPEKFLKGEVE
FT                   PGAHDGAGDGRAGEKEGEDDEAKVIAALRESNPYFDQDMALYEEHHREKLRAEFDRLAR
FT                   ERSELEEVKRLYRGASAGDVDAIESAIWAGADTDTANPLDGGRTALHYACLAGERAAAQ
FT                   VLVEHGANPSALDALGFTPADALKSGEKDPRGEIAGDLELARAAHAHMASLAMKINAGT
FT                   YDVDEPDAPDSMPPLHEAVAARKGALTRFLLAQGASVEKTGGSDGDTPLHIAARTGQER
FT                   MCRLLVLRGAAPDAPAAGGDGSTPLHEALRGVKRNGSKGAHAKIAKLFMDEMKRLGRGA
FT                   EAAAIIAGTRS"
     MSGFHTEDGY NGPSLFGQNG AIVGGVRNKL GHVASEEEKQ QARRTVVVIG IKWLLSPGWR        60
     GDDYRDAVFP AEVAQWFEEQ IGPVQAVHFK PPVQAWVEFN SASNATAALN LNGATYPRKC       120
     KHSPGGRIKV SRATHTELVR GAKDHLRSYH VLIPEKFLKG EVEPGAHDGA GDGRAGEKEG       180
     EDDEAKVIAA LRESNPYFDQ DMALYEEHHR EKLRAEFDRL ARERSELEEV KRLYRGASAG       240
     DVDAIESAIW AGADTDTANP LDGGRTALHY ACLAGERAAA QVLVEHGANP SALDALGFTP       300
     ADALKSGEKD PRGEIAGDLE LARAAHAHMA SLAMKINAGT YDVDEPDAPD SMPPLHEAVA       360
     ARKGALTRFL LAQGASVEKT GGSDGDTPLH IAARTGQERM CRLLVLRGAA PDAPAAGGDG       420
     STPLHEALRG VKRNGSKGAH AKIAKLFMDE MKRLGRGAEA AAIIAGTRS                   469
//

If you have problems or comments...

PBIL Back to PBIL home page