(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE486

MICSR_1.PE486        Location/Qualifiers
FT   CDS             complement(972004..972663)
FT                   /codon_start=1
FT                   /gene_family="HOG000220986" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637404"
FT                   /orf_name="MICPUN_80283"
FT                   /product="Predicted protein"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62259.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG713289"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="UniParc:UPI000199A5DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E213"
FT                   /transl_table=1
FT                   /translation="MSAVSAAAVKELRDKSGAGMMLCKKALTECNGDMEEAVKWLRKKG
FT                   MASADKKAGRVAAEGAIHSYIHGGSRLGVLVEVNCETDFVARGDKFKELVADIAMQVAA
FT                   SPGVEYVSPEDADPAMVAAEKELMMKMEDVVSKPENIREKIIQGRLSKVVNEKALLKQP
FT                   FIKDPSKTVEQLIKEVTAEIGEKISVRRFVKYNLGEGIEKKVEDFAAEVEATRTAT"
     MSAVSAAAVK ELRDKSGAGM MLCKKALTEC NGDMEEAVKW LRKKGMASAD KKAGRVAAEG        60
     AIHSYIHGGS RLGVLVEVNC ETDFVARGDK FKELVADIAM QVAASPGVEY VSPEDADPAM       120
     VAAEKELMMK MEDVVSKPEN IREKIIQGRL SKVVNEKALL KQPFIKDPSK TVEQLIKEVT       180
     AEIGEKISVR RFVKYNLGEG IEKKVEDFAA EVEATRTAT                              219
//

If you have problems or comments...

PBIL Back to PBIL home page