(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE487

MICSR_1.PE487        Location/Qualifiers
FT   CDS             join(975993..976128,976414..977645)
FT                   /codon_start=1
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637405"
FT                   /orf_name="MICPUN_80247"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61840.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000199A5DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E214"
FT                   /transl_table=1
FT                   /translation="MAPFGSKVPLAEPSWYQNLNTPYYNASHVAWRAKLRDFFEKEVEP
FT                   IVDDWDKQASMNNHAACGEYVKRMYAKSAQYGILPACVGKPWPGKYTSAAEPEGYDYFH
FT                   ELINVDEGTRAGGGIAWAMMGGLGIGMPPVLNFGVPGDRALQDRVVRECLAGEKIICLC
FT                   ITEPGAGSDVANLACTAEDKGDHFLVNGNKKWITNGIYADYFTVAVRTGPPGSAHKGLS
FT                   MLLIERNSSPGITTSKMDCMGVWPSGTTYIEFDNVKVPKKNVVGRVGDGFKQIMYNFNH
FT                   ERWLLAAQAARMARTCVEESIAFARSRRTFGKFLIEHQAIQHKIGEMARQCEGLQAWLE
FT                   NVTFQMNTMSKEEQNRKLGGHIALLKLSSSRVAEFCASNAMQVLGGAGYTRSGKGTKVE
FT                   RIYREVKAYAIPGGSEEIMLNLAAGQFGFVTRRAPDPRDKIIKQLKDELKRVHSKI"
     MAPFGSKVPL AEPSWYQNLN TPYYNASHVA WRAKLRDFFE KEVEPIVDDW DKQASMNNHA        60
     ACGEYVKRMY AKSAQYGILP ACVGKPWPGK YTSAAEPEGY DYFHELINVD EGTRAGGGIA       120
     WAMMGGLGIG MPPVLNFGVP GDRALQDRVV RECLAGEKII CLCITEPGAG SDVANLACTA       180
     EDKGDHFLVN GNKKWITNGI YADYFTVAVR TGPPGSAHKG LSMLLIERNS SPGITTSKMD       240
     CMGVWPSGTT YIEFDNVKVP KKNVVGRVGD GFKQIMYNFN HERWLLAAQA ARMARTCVEE       300
     SIAFARSRRT FGKFLIEHQA IQHKIGEMAR QCEGLQAWLE NVTFQMNTMS KEEQNRKLGG       360
     HIALLKLSSS RVAEFCASNA MQVLGGAGYT RSGKGTKVER IYREVKAYAI PGGSEEIMLN       420
     LAAGQFGFVT RRAPDPRDKI IKQLKDELKR VHSKI                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page