(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE488

MICSR_1.PE488        Location/Qualifiers
FT   CDS             join(977864..978909,979111..980788)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637406"
FT                   /orf_name="MICPUN_99553"
FT                   /product="Predicted protein"
FT                   /function="sulfotransferase activity"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61841.1"
FT                   /db_xref="GO:0008146"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniParc:UPI000199A5E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E215"
FT                   /transl_table=1
FT                   /translation="MATTGDAREAEPLLGGGDTGAPASWWPRGRVGALVAGAMLVLLGL
FT                   CAGSAVGPMPTGLSRLGDDDAAPAPTYPAAEEPPLLDPLVSFNTPRCRQTRASLARVTN
FT                   HDGDVVVIPELRAVYVDIVKAASESIRSALEDNFHASWSADLGQYKHPVTGRPQRSSTS
FT                   YLTDDVLANYTFFTFVRDPNTRFRSSYEQAICRERCTLCTARGAGTMYTPTIAEITAFL
FT                   QGRLMHFYGDIALRGERSDEITLQEAWVDEHFESQILRLSGATKDGTPVPLNFVGRVES
FT                   FEHDWARLMDHLGVKEGDPRRVTPGHQEHACDIPERGKVVQRQRASPVTTLEKVAVAAL
FT                   YHDDFECLGIMASWKDGLEGLRERNVTELACVMMSSQKPPYSAEVLEEARKSARKVEGG
FT                   FASRSKHAKEYAAKVAAKKGDLVKKIVKVMPEGVQKEHYQEAIATAAMIDKAAAEAEAQ
FT                   AKTEVKPEVKVEVKPEVKVEVKPEVETEAKPMDVDPPSQQPSSQGTILRQPSDTAAAMA
FT                   QVEKEPLIKTILRRVLERHEIKYHLSTLELDAKRKYSAKAASAVSHAMKKYNEHVEARN
FT                   AKLPPAQRKPGLGEAALVEHITSQAHKMLLAKLKEAAEPKKEEPPAAPKPGDASFVPAA
FT                   RPPGMEGKSFDDLVQYWKRLGELRVAYLPRVRQTLPMLQKYSRGVGQVAANAENFAKMT
FT                   EHTLIPLLSQTADEPMMTAKFTMDELAALEGHVKKLVALAGGRGVNEVPAPAPAAPKPA
FT                   PADEATAGDTKRKRDGEEEEDGEGGDRKRAKTEDAPEPEPEPEPMPAPRAPSAFTGLTS
FT                   CAPDHAHAQPAPPMPSALEGTSEKRPPGKSVGCPVAAEEGELVAAAVYSSDDVSYWAPD
FT                   GELLRRALEGEVIAGTTKSAAMFKAFEELKEVFSSA"
     MATTGDAREA EPLLGGGDTG APASWWPRGR VGALVAGAML VLLGLCAGSA VGPMPTGLSR        60
     LGDDDAAPAP TYPAAEEPPL LDPLVSFNTP RCRQTRASLA RVTNHDGDVV VIPELRAVYV       120
     DIVKAASESI RSALEDNFHA SWSADLGQYK HPVTGRPQRS STSYLTDDVL ANYTFFTFVR       180
     DPNTRFRSSY EQAICRERCT LCTARGAGTM YTPTIAEITA FLQGRLMHFY GDIALRGERS       240
     DEITLQEAWV DEHFESQILR LSGATKDGTP VPLNFVGRVE SFEHDWARLM DHLGVKEGDP       300
     RRVTPGHQEH ACDIPERGKV VQRQRASPVT TLEKVAVAAL YHDDFECLGI MASWKDGLEG       360
     LRERNVTELA CVMMSSQKPP YSAEVLEEAR KSARKVEGGF ASRSKHAKEY AAKVAAKKGD       420
     LVKKIVKVMP EGVQKEHYQE AIATAAMIDK AAAEAEAQAK TEVKPEVKVE VKPEVKVEVK       480
     PEVETEAKPM DVDPPSQQPS SQGTILRQPS DTAAAMAQVE KEPLIKTILR RVLERHEIKY       540
     HLSTLELDAK RKYSAKAASA VSHAMKKYNE HVEARNAKLP PAQRKPGLGE AALVEHITSQ       600
     AHKMLLAKLK EAAEPKKEEP PAAPKPGDAS FVPAARPPGM EGKSFDDLVQ YWKRLGELRV       660
     AYLPRVRQTL PMLQKYSRGV GQVAANAENF AKMTEHTLIP LLSQTADEPM MTAKFTMDEL       720
     AALEGHVKKL VALAGGRGVN EVPAPAPAAP KPAPADEATA GDTKRKRDGE EEEDGEGGDR       780
     KRAKTEDAPE PEPEPEPMPA PRAPSAFTGL TSCAPDHAHA QPAPPMPSAL EGTSEKRPPG       840
     KSVGCPVAAE EGELVAAAVY SSDDVSYWAP DGELLRRALE GEVIAGTTKS AAMFKAFEEL       900
     KEVFSSA                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page