(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE489

MICSR_1.PE489        Location/Qualifiers
FT   CDS             complement(980875..981240)
FT                   /codon_start=1
FT                   /gene_family="HOG000100029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637407"
FT                   /orf_name="MICPUN_80239"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62260.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG560246"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199A5E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E216"
FT                   /transl_table=1
FT                   /translation="MPEAGGNLSAVRGEDQFGRTLWEKGKNGALVVVKYGAAWCKHCPM
FT                   MLPEFGAAARRHPEAHFVLADVDTLPETGKDIRFTPTFSFYRSGVKLDEITRTSPQQLR
FT                   DHVWMHAPDKPYVPDDA"
     MPEAGGNLSA VRGEDQFGRT LWEKGKNGAL VVVKYGAAWC KHCPMMLPEF GAAARRHPEA        60
     HFVLADVDTL PETGKDIRFT PTFSFYRSGV KLDEITRTSP QQLRDHVWMH APDKPYVPDD       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page