(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE49

MICSR_1.PE49         Location/Qualifiers
FT   CDS             98198..99427
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636054"
FT                   /orf_name="MICPUN_56622"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="ACO61608.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI000199ABAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S6"
FT                   /transl_table=1
FT                   /translation="MFSSLASSSVLSLATAPNVGGGRRLRPARGFARDTPFPIRGATLL
FT                   VPSDVSRLVLARASDVREGDYASEDSYDGDDDGAWEGMSSSRNRSATVIRTAGRDDMYL
FT                   EVDLPAHNMGITFTCGPDATIAMVEKVRQDSAAEQAGIEIGDILFSCSAVELTGSDTPV
FT                   VVGDSEGTDTHWRRIDNFRCLGQPFDVQMAAFNSTAIVDAGFKHRIVRAIFRRDVNPDG
FT                   RSRASRLDEMLGDEKAATDDPTEKDAETSVAKLVSESWKDIVSAVTIEGFGELLFKSLF
FT                   RHDWDLVRLFPFRDCESWEEVRAHPKFQSHAVNVAGAIDKAVSLLGNSSELVPVLRGLG
FT                   ERHHGYGVEEEHYDLLGSALLEALEEGTALSGVSPGGRGWTRELGDAWTETWATVAATM
FT                   KGDLYGTSPR"
     MFSSLASSSV LSLATAPNVG GGRRLRPARG FARDTPFPIR GATLLVPSDV SRLVLARASD        60
     VREGDYASED SYDGDDDGAW EGMSSSRNRS ATVIRTAGRD DMYLEVDLPA HNMGITFTCG       120
     PDATIAMVEK VRQDSAAEQA GIEIGDILFS CSAVELTGSD TPVVVGDSEG TDTHWRRIDN       180
     FRCLGQPFDV QMAAFNSTAI VDAGFKHRIV RAIFRRDVNP DGRSRASRLD EMLGDEKAAT       240
     DDPTEKDAET SVAKLVSESW KDIVSAVTIE GFGELLFKSL FRHDWDLVRL FPFRDCESWE       300
     EVRAHPKFQS HAVNVAGAID KAVSLLGNSS ELVPVLRGLG ERHHGYGVEE EHYDLLGSAL       360
     LEALEEGTAL SGVSPGGRGW TRELGDAWTE TWATVAATMK GDLYGTSPR                   409
//

If you have problems or comments...

PBIL Back to PBIL home page