(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE490

MICSR_1.PE490        Location/Qualifiers
FT   CDS             981450..982292
FT                   /codon_start=1
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637408"
FT                   /orf_name="MICPUN_79551"
FT                   /product="Predicted protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO61842.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020552"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000199A5E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E217"
FT                   /transl_table=1
FT                   /translation="MAEIDHAACLVAAELAARAAGEEIKAAWDAERDVEYKGTVDLVTA
FT                   TDKKCEDLIFDMLQSKFPTHAFVGEESVAAADGKLPEIGDEPTWFVDPLDGTTNFVHAF
FT                   PFSCVSIGLAVKKKPVIGVVFNPISNECFTAVVGNGARLNGKPISVSKVSDLGKALIGT
FT                   EIGVSRDAATVDAIMGRVRACVENARSLRCSGSCAMNMVGVAMGRLDGFYEIGFGGPWD
FT                   CVGAAVIVTEAGGVVCDPSGKPFELTARRVLCGNPDIAPALTKVLTAIPDGPLEPQAP"
     MAEIDHAACL VAAELAARAA GEEIKAAWDA ERDVEYKGTV DLVTATDKKC EDLIFDMLQS        60
     KFPTHAFVGE ESVAAADGKL PEIGDEPTWF VDPLDGTTNF VHAFPFSCVS IGLAVKKKPV       120
     IGVVFNPISN ECFTAVVGNG ARLNGKPISV SKVSDLGKAL IGTEIGVSRD AATVDAIMGR       180
     VRACVENARS LRCSGSCAMN MVGVAMGRLD GFYEIGFGGP WDCVGAAVIV TEAGGVVCDP       240
     SGKPFELTAR RVLCGNPDIA PALTKVLTAI PDGPLEPQAP                             280
//

If you have problems or comments...

PBIL Back to PBIL home page