(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE491

MICSR_1.PE491        Location/Qualifiers
FT   CDS             join(complement(983287..984084),complement(982387..983136))
FT                   /codon_start=1
FT                   /gene_family="HOG000264977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637409"
FT                   /orf_name="MICPUN_80181"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62261.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG560248"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199A5E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E218"
FT                   /transl_table=1
FT                   /translation="MPILLRRTSTGSGFTVGASGRDGVGGALKSVDLYAKMPRELAEGT
FT                   YLGGVFSILLMFVFVSLFGMQLRALWTVGTRTDIAVDHSEDAKFQVNFKVELPALSCEW
FT                   ATVDVIDALGTRHFNISGESIYKHSMGASRYLGVEHASAGRESQREPEYGDTTDLDHYG
FT                   NRRIAYEVTGATFERMIRAHKVLLVEFHAPWCSHCQRLAPIYEHAAELVRSELRRGKRA
FT                   RLAAALATVDCTIESNKDLCKEQHVQAFPTLRVYRAGSLHPVDLVQSVADAKAESSYDD
FT                   EFSETNARAAAMKAAEMARAAKSLGGQIRTSGCIIDGSFRVNRVPGAFYVTPHSMGHNL
FT                   NPDVINMTHTVKHLSFGKHVPGRPSYVPRNLRRVWNRVPKDLGGRFAAGDEATFYSEEP
FT                   NTVHEHYLKIVSRTFEPLEGQAVQLYEYTFNSNRFRLNPPLAADGDPDQHVDGPMIKFS
FT                   YDVSPMSVVLKEVKKPLLDWILGMCALLGGVYTCAGLLETFLQSSVCAVKRRVGKIS"
     MPILLRRTST GSGFTVGASG RDGVGGALKS VDLYAKMPRE LAEGTYLGGV FSILLMFVFV        60
     SLFGMQLRAL WTVGTRTDIA VDHSEDAKFQ VNFKVELPAL SCEWATVDVI DALGTRHFNI       120
     SGESIYKHSM GASRYLGVEH ASAGRESQRE PEYGDTTDLD HYGNRRIAYE VTGATFERMI       180
     RAHKVLLVEF HAPWCSHCQR LAPIYEHAAE LVRSELRRGK RARLAAALAT VDCTIESNKD       240
     LCKEQHVQAF PTLRVYRAGS LHPVDLVQSV ADAKAESSYD DEFSETNARA AAMKAAEMAR       300
     AAKSLGGQIR TSGCIIDGSF RVNRVPGAFY VTPHSMGHNL NPDVINMTHT VKHLSFGKHV       360
     PGRPSYVPRN LRRVWNRVPK DLGGRFAAGD EATFYSEEPN TVHEHYLKIV SRTFEPLEGQ       420
     AVQLYEYTFN SNRFRLNPPL AADGDPDQHV DGPMIKFSYD VSPMSVVLKE VKKPLLDWIL       480
     GMCALLGGVY TCAGLLETFL QSSVCAVKRR VGKIS                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page