(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE492

MICSR_1.PE492        Location/Qualifiers
FT   CDS             join(complement(985080..985451),complement(984255..985028))
FT                   /codon_start=1
FT                   /gene_family="HOG000264978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637410"
FT                   /orf_name="MICPUN_79531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62262.1"
FT                   /db_xref="HOGENOM:HBG409849"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A5E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E219"
FT                   /transl_table=1
FT                   /translation="MLAQEKLVPKPPIRTTVGYNFEHDNDLREAYRNPWNEVRIGRVLE
FT                   DLDSLAGNIAFAHCDDADVATRPQLLVTASVDRVRLLRPLRLKEDMTLTGAVAWVGTSS
FT                   IVIRMEAWPADHPDAPTDPDPGPSLTADFTFVARDSVTNKGAPVNPLVPETDEQRDLFE
FT                   RTARRVEAKRARMRSERTNGADGALSPELAESKRLFVEDVTRAARALRELPALAPAQDV
FT                   AMDATRTENMFVAQPQQRNLSGRIFGGFLLRRAFELAFATTYVFGGAKPKFHSVADMNF
FT                   LRPVEVGDLMRIRARVLHATRTSCGRPSVDVEVEALVTKPESLRSEVSNTFMFKFDVGD
FT                   ANEGRVVRRVLPSSREEAAHVWEKCVRPDVQARLEEQTPLI"
     MLAQEKLVPK PPIRTTVGYN FEHDNDLREA YRNPWNEVRI GRVLEDLDSL AGNIAFAHCD        60
     DADVATRPQL LVTASVDRVR LLRPLRLKED MTLTGAVAWV GTSSIVIRME AWPADHPDAP       120
     TDPDPGPSLT ADFTFVARDS VTNKGAPVNP LVPETDEQRD LFERTARRVE AKRARMRSER       180
     TNGADGALSP ELAESKRLFV EDVTRAARAL RELPALAPAQ DVAMDATRTE NMFVAQPQQR       240
     NLSGRIFGGF LLRRAFELAF ATTYVFGGAK PKFHSVADMN FLRPVEVGDL MRIRARVLHA       300
     TRTSCGRPSV DVEVEALVTK PESLRSEVSN TFMFKFDVGD ANEGRVVRRV LPSSREEAAH       360
     VWEKCVRPDV QARLEEQTPL I                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page