(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE493

MICSR_1.PE493        Location/Qualifiers
FT   CDS             985948..987432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637411"
FT                   /orf_name="MICPUN_112704"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61843.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199A5E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E220"
FT                   /transl_table=1
FT                   /translation="MSSEPSPSPPTAICLTIKNLTKRDFTLGEVPLALTVGELKARIES
FT                   EYEGNPPPNTQRIVYAGALLRDESAGLADVVKASDLEAGAVVFHLVLPAEASSTASTPA
FT                   STPGATPASAREPGAETSTPSSAPSPADGRLPAQPGTPPPAPRADQQSAYPPQPEATPA
FT                   FGFSNQPPPATTQPGSSRPTTPGMTPTVAAYPPPYAGLGAHSPHVQAVYASAYAAAFNS
FT                   LSPGGSPAPGAPVAVPVPVPVFGFGGGWGAPGWGAPGWNGAPGGYQQHGAPGQQQHHAV
FT                   LAPGQQQPTTPTPPRFDLNDPDQAARAVAQAVRDGDPVAAAAAAAAAAAGGRPVHVMQI
FT                   HIDLRLIMKLAMIVAVASQGATNVRMAIYAAMAVVVYLFQTGAVAWVIRRFLPDILDEQ
FT                   ADGMVGGMGAVGGGGAGRAGGAAAPPPRRRPPQGPRTNAVLPGMRDGMPRSWFGEIKVL
FT                   VCGFLASLLPSWQPPELYRHPRPGAAAAGPERPHQD"
     MSSEPSPSPP TAICLTIKNL TKRDFTLGEV PLALTVGELK ARIESEYEGN PPPNTQRIVY        60
     AGALLRDESA GLADVVKASD LEAGAVVFHL VLPAEASSTA STPASTPGAT PASAREPGAE       120
     TSTPSSAPSP ADGRLPAQPG TPPPAPRADQ QSAYPPQPEA TPAFGFSNQP PPATTQPGSS       180
     RPTTPGMTPT VAAYPPPYAG LGAHSPHVQA VYASAYAAAF NSLSPGGSPA PGAPVAVPVP       240
     VPVFGFGGGW GAPGWGAPGW NGAPGGYQQH GAPGQQQHHA VLAPGQQQPT TPTPPRFDLN       300
     DPDQAARAVA QAVRDGDPVA AAAAAAAAAA GGRPVHVMQI HIDLRLIMKL AMIVAVASQG       360
     ATNVRMAIYA AMAVVVYLFQ TGAVAWVIRR FLPDILDEQA DGMVGGMGAV GGGGAGRAGG       420
     AAAPPPRRRP PQGPRTNAVL PGMRDGMPRS WFGEIKVLVC GFLASLLPSW QPPELYRHPR       480
     PGAAAAGPER PHQD                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page