(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE50

MICSR_1.PE50         Location/Qualifiers
FT   CDS             complement(99580..102867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636055"
FT                   /orf_name="MICPUN_56623"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62054.1"
FT                   /db_xref="UniParc:UPI000199ABAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S7"
FT                   /transl_table=1
FT                   /translation="MPSRFPHGGEDAPLLAGDSRGRGGNAKKSDSGADRLLSRGVTALA
FT                   ALLLIGLCVMLGVHLMGSYHSADSDLSNKDRSWIETLDDGTKILHGADGKLSIVSGDAG
FT                   KKSSKHHKKKKGTDDILDLLHNENAKGSIEGEIDPNKDIASQQNDILLNKEKEMMDQLT
FT                   AMAKGKGGPDAKGSSKKPSVNPAEAAEKMLAGGNAPTTSTFDPRAALRHHEEALEHLST
FT                   KDKKANENLKLTDQEKSELEQLEELTRKPPPGPPAYVTPEEQLLHKAAMKAKKHDEKGA
FT                   EDWYNQLDDSVDVFEVRNQALIELEEASHKKDDKKGAEGVESTKASAKHAAKASAKAKA
FT                   TKPSAEPIASTELEPVASTEPEPVASTEPEPVADKEGEVAKTGEDELEADVELADTEPE
FT                   PEPEPEPVEPFGAHDSEAKNDDEDGPDPAEPIEPFGAHDSKVEAEPEADDDDEPVEPVE
FT                   PFGHDDEKDAEPVEEKPDAVEEEAEAAEKEEEPEPVAAKAEDPEPAANAEKEEEPEPVA
FT                   AKEEEPEPAAAAEKEEEPEPAAAADPTSAAPASDAGDKHPTPEQIKWWKDHHPNGAALG
FT                   HRTRNRRPVSRRPRHEAEAALGVAPSNPKASSVPASRWSGVDLAQHLSCSDSLADPATG
FT                   KTFDVATEFYMSDETTLGPNGEAIKLGPRARAVRDTTFVSAFLRVDGPGAPDPTRYLTG
FT                   VRHAACNAGRARLNSVFFADSPEMCAHVRRLYDNGRALSNELAPPVPRLGSGKFRCQVK
FT                   AVKNLPLKPATGLRPEAVIGGCANSANAFVWYNKVNFMVDAAEMCESDPDAEKTSQFAW
FT                   FDGDVAGPGALKALLAHPLDPAALVAGAKDEKVHFTCHPRAVREAQAVEPCRAGETMVM
FT                   PRVFSGTPQALRGFKRRWDAYMHRYVPLSTHTAAELGQWRMARGFFADYKNPPNAARGA
FT                   GLKPVEAAIAVNTRSGGWTCPCPSEEYVMNRLLNDEMFPEEKQFSGGKIAMLVTQEEKA
FT                   REEEKAQLTAKGGDAVAGMGGPRRPAAQAGVGTASSFSLRRGLGLLEDGLNAAALGAEA
FT                   IESDVPGKQFIDASPDGTDGSCARSEDGTPSGFAELPSMGLISWRFN"
     MPSRFPHGGE DAPLLAGDSR GRGGNAKKSD SGADRLLSRG VTALAALLLI GLCVMLGVHL        60
     MGSYHSADSD LSNKDRSWIE TLDDGTKILH GADGKLSIVS GDAGKKSSKH HKKKKGTDDI       120
     LDLLHNENAK GSIEGEIDPN KDIASQQNDI LLNKEKEMMD QLTAMAKGKG GPDAKGSSKK       180
     PSVNPAEAAE KMLAGGNAPT TSTFDPRAAL RHHEEALEHL STKDKKANEN LKLTDQEKSE       240
     LEQLEELTRK PPPGPPAYVT PEEQLLHKAA MKAKKHDEKG AEDWYNQLDD SVDVFEVRNQ       300
     ALIELEEASH KKDDKKGAEG VESTKASAKH AAKASAKAKA TKPSAEPIAS TELEPVASTE       360
     PEPVASTEPE PVADKEGEVA KTGEDELEAD VELADTEPEP EPEPEPVEPF GAHDSEAKND       420
     DEDGPDPAEP IEPFGAHDSK VEAEPEADDD DEPVEPVEPF GHDDEKDAEP VEEKPDAVEE       480
     EAEAAEKEEE PEPVAAKAED PEPAANAEKE EEPEPVAAKE EEPEPAAAAE KEEEPEPAAA       540
     ADPTSAAPAS DAGDKHPTPE QIKWWKDHHP NGAALGHRTR NRRPVSRRPR HEAEAALGVA       600
     PSNPKASSVP ASRWSGVDLA QHLSCSDSLA DPATGKTFDV ATEFYMSDET TLGPNGEAIK       660
     LGPRARAVRD TTFVSAFLRV DGPGAPDPTR YLTGVRHAAC NAGRARLNSV FFADSPEMCA       720
     HVRRLYDNGR ALSNELAPPV PRLGSGKFRC QVKAVKNLPL KPATGLRPEA VIGGCANSAN       780
     AFVWYNKVNF MVDAAEMCES DPDAEKTSQF AWFDGDVAGP GALKALLAHP LDPAALVAGA       840
     KDEKVHFTCH PRAVREAQAV EPCRAGETMV MPRVFSGTPQ ALRGFKRRWD AYMHRYVPLS       900
     THTAAELGQW RMARGFFADY KNPPNAARGA GLKPVEAAIA VNTRSGGWTC PCPSEEYVMN       960
     RLLNDEMFPE EKQFSGGKIA MLVTQEEKAR EEEKAQLTAK GGDAVAGMGG PRRPAAQAGV      1020
     GTASSFSLRR GLGLLEDGLN AAALGAEAIE SDVPGKQFID ASPDGTDGSC ARSEDGTPSG      1080
     FAELPSMGLI SWRFN                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page