(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE501

MICSR_1.PE501        Location/Qualifiers
FT   CDS             join(complement(1004267..1004336),
FT                   complement(1001887..1004147))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637419"
FT                   /orf_name="MICPUN_57087"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62267.1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="UniParc:UPI000199A65F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E228"
FT                   /transl_table=1
FT                   /translation="MKRPGLLAIALALVVGVQSVRSEAPPPPCSGHGTLNPDSTCSCEN
FT                   PRPAAGATGWTGGLCQVPVVGLATQTIGTNEAQSDSLESATWKCYHMATPAATDWNYLS
FT                   LELKQLDGDPDVYGMLYNATDDGRYPTGNTQGWDFREVSSSARGSVRLTVGKRDWAHPN
FT                   DAAEGVYICVTAYGDRVASYELRSVFTRCPAAFAIDSETGATVATQCSAPATGGTTNPT
FT                   DVPGACDEASGTCACKAYADHAYVAPEGSEHDDVPPELGFDSCSARIDFVPSASKSESW
FT                   DDVTLAADAWTFYRFEITDDDYQIQVTMERDEDEGGTARLFLRHETLPDSRWGHHDLPD
FT                   DFVSGTRPTQEVLVTRGDVAFVAGTWYAGVHAGADASSKFTLTVQRFDCPRDCSGRGEC
FT                   VHEQNGTRTCACDTGPLGPYLGPGCEDEYSGLTPSADGWHVNGTLGASDYDFFALPDID
FT                   IRESKRQIELVLSARYDRDETSYYWRPERPVLLLNHGDRSAFPSADNYTFKVTMEERSK
FT                   EYSIQLCAAQMRGSKWQAALYNPARTIPMVYSMSFRKKGVCPSATDGECSDNGDCVADV
FT                   TSPDFATCRCKTGWAGADCNFRACPEGSFIAVPGEGHGTCYRECVDGKHRPDGCDRVAC
FT                   DPPARSAADGSGCVMDECSNDLFFVDSGSDVSCVKRCVASSAGSPKRLSEECDPDTVRG
FT                   AGGSSGSRRRLGFPGVMVLIVVALSVIAGGVGYYAYSSCGGAEALGTLRGALAWGNGRG
FT                   FRRYDRFEGERFDDFAAADFDTP"
     MKRPGLLAIA LALVVGVQSV RSEAPPPPCS GHGTLNPDST CSCENPRPAA GATGWTGGLC        60
     QVPVVGLATQ TIGTNEAQSD SLESATWKCY HMATPAATDW NYLSLELKQL DGDPDVYGML       120
     YNATDDGRYP TGNTQGWDFR EVSSSARGSV RLTVGKRDWA HPNDAAEGVY ICVTAYGDRV       180
     ASYELRSVFT RCPAAFAIDS ETGATVATQC SAPATGGTTN PTDVPGACDE ASGTCACKAY       240
     ADHAYVAPEG SEHDDVPPEL GFDSCSARID FVPSASKSES WDDVTLAADA WTFYRFEITD       300
     DDYQIQVTME RDEDEGGTAR LFLRHETLPD SRWGHHDLPD DFVSGTRPTQ EVLVTRGDVA       360
     FVAGTWYAGV HAGADASSKF TLTVQRFDCP RDCSGRGECV HEQNGTRTCA CDTGPLGPYL       420
     GPGCEDEYSG LTPSADGWHV NGTLGASDYD FFALPDIDIR ESKRQIELVL SARYDRDETS       480
     YYWRPERPVL LLNHGDRSAF PSADNYTFKV TMEERSKEYS IQLCAAQMRG SKWQAALYNP       540
     ARTIPMVYSM SFRKKGVCPS ATDGECSDNG DCVADVTSPD FATCRCKTGW AGADCNFRAC       600
     PEGSFIAVPG EGHGTCYREC VDGKHRPDGC DRVACDPPAR SAADGSGCVM DECSNDLFFV       660
     DSGSDVSCVK RCVASSAGSP KRLSEECDPD TVRGAGGSSG SRRRLGFPGV MVLIVVALSV       720
     IAGGVGYYAY SSCGGAEALG TLRGALAWGN GRGFRRYDRF EGERFDDFAA ADFDTP           776
//

If you have problems or comments...

PBIL Back to PBIL home page