(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE502

MICSR_1.PE502        Location/Qualifiers
FT   CDS             join(1004678..1004803,1005011..1006933)
FT                   /codon_start=1
FT                   /gene_family="HOG000167988" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637420"
FT                   /orf_name="MICPUN_93721"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO61847.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG320237"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199A660"
FT                   /db_xref="UniProtKB/TrEMBL:C1E229"
FT                   /transl_table=1
FT                   /translation="MTAETQQANELYEAKNVLITGGAGFIASHVAILFAKKYPQYKVVV
FT                   VDKLDYCANLNNLRSIAGLLNFKFVKGDVGSADLMTYVMRSEEIDTVMHFAAQTHVDNS
FT                   FGNSFEFTENNIRGTHVLLETVKTLGTIKRFLHVSTDEVYGESSYEKDEANVEAASLLE
FT                   PTNPYSATKAGAEMLVMAYGRSYNLPYIITRGNNVYGPHQYPEKAIPKFIMLAQSGGTI
FT                   PIHGDGMATRSYMHVYDAASAFDTILHKGAIKGVYNIGAHEERTVLSVAQDIGKSLGKD
FT                   ISKTIVHVSDRKFNDRRYFIDCSKLLALGWTQQVSWEEGLKETIDWYTNNGQASGYWGN
FT                   LSGALVAHPTGGKPQLEGEVYQSLEEMMAAQERERAAEREEGKGEKKPMFLVYGRTGWI
FT                   GGKLGKLLTELGHDWCYGSARLQDRVGVQDDIKRSKCTHILNAAGVTGRPNVDWCEDHK
FT                   VETIRANVIGVLQLCDVALENNVHVTNFATGCIYKYDDAHTIGGVPFTEEDDPNFGGSF
FT                   YSETKSYMEMMLRHYPNVMQCRVRMPIDGDLQNPRNFITKIANYAKVVNIPNSMTVLEE
FT                   FVPMAVEGALRGLTGAYNWTNPGAISHNEVLELYRDYLHPEFTWENFTEEEQAEVIKAP
FT                   RSNNTMCDKKIRAAFPQVLGIKESIIKYVMEPNKKAGMRAPIKREIK"
     MTAETQQANE LYEAKNVLIT GGAGFIASHV AILFAKKYPQ YKVVVVDKLD YCANLNNLRS        60
     IAGLLNFKFV KGDVGSADLM TYVMRSEEID TVMHFAAQTH VDNSFGNSFE FTENNIRGTH       120
     VLLETVKTLG TIKRFLHVST DEVYGESSYE KDEANVEAAS LLEPTNPYSA TKAGAEMLVM       180
     AYGRSYNLPY IITRGNNVYG PHQYPEKAIP KFIMLAQSGG TIPIHGDGMA TRSYMHVYDA       240
     ASAFDTILHK GAIKGVYNIG AHEERTVLSV AQDIGKSLGK DISKTIVHVS DRKFNDRRYF       300
     IDCSKLLALG WTQQVSWEEG LKETIDWYTN NGQASGYWGN LSGALVAHPT GGKPQLEGEV       360
     YQSLEEMMAA QERERAAERE EGKGEKKPMF LVYGRTGWIG GKLGKLLTEL GHDWCYGSAR       420
     LQDRVGVQDD IKRSKCTHIL NAAGVTGRPN VDWCEDHKVE TIRANVIGVL QLCDVALENN       480
     VHVTNFATGC IYKYDDAHTI GGVPFTEEDD PNFGGSFYSE TKSYMEMMLR HYPNVMQCRV       540
     RMPIDGDLQN PRNFITKIAN YAKVVNIPNS MTVLEEFVPM AVEGALRGLT GAYNWTNPGA       600
     ISHNEVLELY RDYLHPEFTW ENFTEEEQAE VIKAPRSNNT MCDKKIRAAF PQVLGIKESI       660
     IKYVMEPNKK AGMRAPIKRE IK                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page