(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE503

MICSR_1.PE503        Location/Qualifiers
FT   CDS             1007244..1007687
FT                   /codon_start=1
FT                   /gene_family="HOG000012755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637421"
FT                   /orf_name="MICPUN_57089"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO61848.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG609650"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="UniParc:UPI000199A661"
FT                   /db_xref="UniProtKB/TrEMBL:C1E230"
FT                   /transl_table=1
FT                   /translation="MLATRVAPSAVFLRGAAVKSSARPVRVAGRGPVTTQAFFGGFGGG
FT                   VPKANGQPMICIDCGYIYRGDFDALPRDYKCPQCNVGKNRFKVVEQAGSSYANLAAQKK
FT                   ANKAAAAKAKKGKGPSPRELAKQKLLEAQEEKDRKKGGGFFGR"
     MLATRVAPSA VFLRGAAVKS SARPVRVAGR GPVTTQAFFG GFGGGVPKAN GQPMICIDCG        60
     YIYRGDFDAL PRDYKCPQCN VGKNRFKVVE QAGSSYANLA AQKKANKAAA AKAKKGKGPS       120
     PRELAKQKLL EAQEEKDRKK GGGFFGR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page