(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE504

MICSR_1.PE504        Location/Qualifiers
FT   CDS             join(complement(1009287..1009351),
FT                   complement(1007773..1009015))
FT                   /codon_start=1
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637422"
FT                   /orf_name="MICPUN_90282"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62268.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000199A662"
FT                   /db_xref="UniProtKB/TrEMBL:C1E231"
FT                   /transl_table=1
FT                   /translation="MSSSLRRLATTVARAAAPVYQGTSRAAGWRQTTPALWRTARAYDV
FT                   NSRSKEHLNIGTIGHVDHGKTTLTAAITKVLAEIGGAEVVAFDQIDKAPEEKARGITIS
FT                   TSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHILLA
FT                   RQVGVPNLAVFLNKVDMVDDEELIDLVEMELREMLSFYKFDGDNIPIVRGSALHALKGT
FT                   DDKLGKEAILELMKACDAFPSPERVLDKPFSMPVEDVFSIQGRGTVATGRIEQGIVKAG
FT                   EDVELIGIVPTQKTTVTGVEMFKKSLTQGQAGDNCGLLLRGLKRDQVQRGQVLCKPGSI
FT                   TPHKKFEAEIYVLNKDEGGRHTPFFSNYRPQFFMRTADITGTITLPEGTEMVMPGDNIT
FT                   AVFELITPIALEKGLRFALREGGRTVGAGIVSKVLD"
     MSSSLRRLAT TVARAAAPVY QGTSRAAGWR QTTPALWRTA RAYDVNSRSK EHLNIGTIGH        60
     VDHGKTTLTA AITKVLAEIG GAEVVAFDQI DKAPEEKARG ITISTSHVEY ETDKRHYAHV       120
     DCPGHADYVK NMITGAAQMD GGILVVSAAD GPMPQTREHI LLARQVGVPN LAVFLNKVDM       180
     VDDEELIDLV EMELREMLSF YKFDGDNIPI VRGSALHALK GTDDKLGKEA ILELMKACDA       240
     FPSPERVLDK PFSMPVEDVF SIQGRGTVAT GRIEQGIVKA GEDVELIGIV PTQKTTVTGV       300
     EMFKKSLTQG QAGDNCGLLL RGLKRDQVQR GQVLCKPGSI TPHKKFEAEI YVLNKDEGGR       360
     HTPFFSNYRP QFFMRTADIT GTITLPEGTE MVMPGDNITA VFELITPIAL EKGLRFALRE       420
     GGRTVGAGIV SKVLD                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page