(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE51

MICSR_1.PE51         Location/Qualifiers
FT   CDS             103342..105057
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636056"
FT                   /orf_name="MICPUN_56624"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61609.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000199ABAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S8"
FT                   /transl_table=1
FT                   /translation="MACAVLHPPSPVAEMFGRRPAEPSAGLPFSQATLDRLATAAADLR
FT                   RFLARVHFAHETVPGMMPGALYHPTEVFDLAKARYEHVWMPLLASENSASPRKLAAPLD
FT                   VQWMHHLHRLDPDAYRVDCERAFGRLVDPADPFLVAGDGAPSDDQAAESFARDAWNAIA
FT                   PEWPFDLEAALVDHRRRGGRLPPRGSSSAISFDSSSCDMIGSATRQGGFLWQVLPSETY
FT                   GDEDFIHRAARRYAMLVILWRDFPGEFLVPTYDQDLVWHAHLSVPSVYEKEMRTATYRN
FT                   AIGHDDSVNDRTPGAKLEVRGRRTMELWRTHYPVSTWDEPYARRGAMWRGDAPDWYWTC
FT                   QFPRPIPPSRAPGPVTEGSTFNQRIPAVELAPNVFYAPPSRIYDYTSRGNEKSGWICTF
FT                   EELVPPPFERAVDPGVQYVKVKVRYAGTTELVEGAWLRFQVPIGIFPPEFIADVDDASF
FT                   ITTCSFPVPHCEKYLHATFVTPVDIRHVIAQYQNRGCCVFCCGGGQQKNDYGLGPARQP
FT                   TTSSYGGGCGAACGSGGGGVGGACGGSYGGGGCGGGGCGGGGGGCGGGGGCGGG"
     MACAVLHPPS PVAEMFGRRP AEPSAGLPFS QATLDRLATA AADLRRFLAR VHFAHETVPG        60
     MMPGALYHPT EVFDLAKARY EHVWMPLLAS ENSASPRKLA APLDVQWMHH LHRLDPDAYR       120
     VDCERAFGRL VDPADPFLVA GDGAPSDDQA AESFARDAWN AIAPEWPFDL EAALVDHRRR       180
     GGRLPPRGSS SAISFDSSSC DMIGSATRQG GFLWQVLPSE TYGDEDFIHR AARRYAMLVI       240
     LWRDFPGEFL VPTYDQDLVW HAHLSVPSVY EKEMRTATYR NAIGHDDSVN DRTPGAKLEV       300
     RGRRTMELWR THYPVSTWDE PYARRGAMWR GDAPDWYWTC QFPRPIPPSR APGPVTEGST       360
     FNQRIPAVEL APNVFYAPPS RIYDYTSRGN EKSGWICTFE ELVPPPFERA VDPGVQYVKV       420
     KVRYAGTTEL VEGAWLRFQV PIGIFPPEFI ADVDDASFIT TCSFPVPHCE KYLHATFVTP       480
     VDIRHVIAQY QNRGCCVFCC GGGQQKNDYG LGPARQPTTS SYGGGCGAAC GSGGGGVGGA       540
     CGGSYGGGGC GGGGCGGGGG GCGGGGGCGG G                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page