(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE53

MICSR_1.PE53         Location/Qualifiers
FT   CDS             complement(107042..107296)
FT                   /codon_start=1
FT                   /gene_family="HOG000238827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636058"
FT                   /orf_name="MICPUN_56626"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62056.1"
FT                   /db_xref="HOGENOM:HBG560273"
FT                   /db_xref="UniParc:UPI000199ABAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T0"
FT                   /transl_table=1
FT                   /translation="MSQFLRQLGALKVKEVPKFLQDKVTVANVTSHTQKFIAEYKTKYI
FT                   DAGSPMPIYHVMCGVFVTAYITVWPTEYRHMMAAKHGHH"
     MSQFLRQLGA LKVKEVPKFL QDKVTVANVT SHTQKFIAEY KTKYIDAGSP MPIYHVMCGV        60
     FVTAYITVWP TEYRHMMAAK HGHH                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page