(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE54

MICSR_1.PE54         Location/Qualifiers
FT   CDS             complement(107502..108644)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636059"
FT                   /orf_name="MICPUN_107857"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62057.1"
FT                   /db_xref="UniParc:UPI000199ABB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T1"
FT                   /transl_table=1
FT                   /translation="MISATIATCRAAPATSVPRSRAAARAVPSAMRPAPTAISRSRVAA
FT                   RSAPAFREARRVRGAALLARASKGDRVSIGDMKKALVAAGVDTSSCFERADLEAKYALL
FT                   TDDQKAMKGGGSSGASAGSGSGASSSSTQQQEQQRASSSSSSSSSSSSSSSTSSSSSSS
FT                   SSSSETKKDSGSGFDPSKVFQSVLNTIRETANRVDVKWGVGAKLREQTKGFRDAIVNLD
FT                   EKLGATAFVKRVAPPAWAEVQKFRATPLGRIANSVFFIWLFFSGFFWTLVTLGITGVFL
FT                   TNLLFPNFFAERAQKMQAEAQARFREQQAAGMGGMGGNPYGGMGGMGGMGGMGGNPYGG
FT                   MGGMGGMGGGGGTGGGSSSAGRKSYGSGDVFDVDADVKDA"
     MISATIATCR AAPATSVPRS RAAARAVPSA MRPAPTAISR SRVAARSAPA FREARRVRGA        60
     ALLARASKGD RVSIGDMKKA LVAAGVDTSS CFERADLEAK YALLTDDQKA MKGGGSSGAS       120
     AGSGSGASSS STQQQEQQRA SSSSSSSSSS SSSSSTSSSS SSSSSSSETK KDSGSGFDPS       180
     KVFQSVLNTI RETANRVDVK WGVGAKLREQ TKGFRDAIVN LDEKLGATAF VKRVAPPAWA       240
     EVQKFRATPL GRIANSVFFI WLFFSGFFWT LVTLGITGVF LTNLLFPNFF AERAQKMQAE       300
     AQARFREQQA AGMGGMGGNP YGGMGGMGGM GGMGGNPYGG MGGMGGMGGG GGTGGGSSSA       360
     GRKSYGSGDV FDVDADVKDA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page