(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE55

MICSR_1.PE55         Location/Qualifiers
FT   CDS             108818..109318
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636060"
FT                   /orf_name="MICPUN_56628"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61610.1"
FT                   /db_xref="UniParc:UPI000199ABB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T2"
FT                   /transl_table=1
FT                   /translation="MSRAFIVASTSSGLVAPGRAPRTRHSGPNPVALKPIGRSPAYAPS
FT                   LKKKEDDVGGSRNKPGIARLFGGGNSDMKAKVAQLEYELENERAHASELGGKLRAVEGE
FT                   LAKVKDSLDLYKGRCKEQEKEIFKLEKKNEETQRGFDTGMAVAKKQIKYLEELLEEEKR
FT                   KNQ"
     MSRAFIVAST SSGLVAPGRA PRTRHSGPNP VALKPIGRSP AYAPSLKKKE DDVGGSRNKP        60
     GIARLFGGGN SDMKAKVAQL EYELENERAH ASELGGKLRA VEGELAKVKD SLDLYKGRCK       120
     EQEKEIFKLE KKNEETQRGF DTGMAVAKKQ IKYLEELLEE EKRKNQ                      166
//

If you have problems or comments...

PBIL Back to PBIL home page