(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE56

MICSR_1.PE56         Location/Qualifiers
FT   CDS             complement(109375..109887)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636061"
FT                   /orf_name="MICPUN_56629"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62058.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ABB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T3"
FT                   /transl_table=1
FT                   /translation="MEKTTIWRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAHV
FT                   GPCEHGVKYRSYCKVCSACSHGRRRSTCKECGGASICEHGRVRSQCKECGGSEICEHGR
FT                   RRSLCKECGGGSICEHGRQRSQCKECGGGSICEHGRRRSTCKECGGGSICEHGRRRFRC
FT                   KECGKEC"
     MEKTTIWRPN VRIDIEDVVA DAEVADEVND ASLTKKGTKR KRAHVGPCEH GVKYRSYCKV        60
     CSACSHGRRR STCKECGGAS ICEHGRVRSQ CKECGGSEIC EHGRRRSLCK ECGGGSICEH       120
     GRQRSQCKEC GGGSICEHGR RRSTCKECGG GSICEHGRRR FRCKECGKEC                  170
//

If you have problems or comments...

PBIL Back to PBIL home page