(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE57

MICSR_1.PE57         Location/Qualifiers
FT   CDS             109990..110217
FT                   /codon_start=1
FT                   /gene_family="HOG000199698" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636062"
FT                   /orf_name="MICPUN_79527"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="ACO61611.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG560304"
FT                   /db_xref="InterPro:IPR009400"
FT                   /db_xref="UniParc:UPI000199ABB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T4"
FT                   /transl_table=1
FT                   /translation="MVSAVHGSLIETDIPCKVYILHINEQLPPAERFVIQDLDETHLLV
FT                   QPHRLEYVKAEVKAWQQKNQFTPPTDLRQT"
     MVSAVHGSLI ETDIPCKVYI LHINEQLPPA ERFVIQDLDE THLLVQPHRL EYVKAEVKAW        60
     QQKNQFTPPT DLRQT                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page