(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE58

MICSR_1.PE58         Location/Qualifiers
FT   CDS             110227..110973
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636063"
FT                   /orf_name="MICPUN_79527"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61612.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000199ABB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T5"
FT                   /transl_table=1
FT                   /translation="MGVATVTPVIAAPRPTHRPGGRKSRVVRANALEIADVVRVASDGG
FT                   VVLAGYVASDLVAQASETRSAERSAEECRVDVDCEIPPTPQGLDVIRLNRYAAFGWFDG
FT                   CISHVFIGWLDAASSGWTSNEAARCFDQVVVDMALFSPVWCALFLISMEAMMMDTRLPL
FT                   RAAVSARLKGEYSELLLGNLGFWIPANAVVFGLVAVDYRVAAFSAINFAYTVLLSIWAE
FT                   GDKDKPQEAADKEKVETKEIETVDQI"
     MGVATVTPVI AAPRPTHRPG GRKSRVVRAN ALEIADVVRV ASDGGVVLAG YVASDLVAQA        60
     SETRSAERSA EECRVDVDCE IPPTPQGLDV IRLNRYAAFG WFDGCISHVF IGWLDAASSG       120
     WTSNEAARCF DQVVVDMALF SPVWCALFLI SMEAMMMDTR LPLRAAVSAR LKGEYSELLL       180
     GNLGFWIPAN AVVFGLVAVD YRVAAFSAIN FAYTVLLSIW AEGDKDKPQE AADKEKVETK       240
     EIETVDQI                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page