(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE59

MICSR_1.PE59         Location/Qualifiers
FT   CDS             join(complement(111131..112881),complement(111081..111096))
FT                   /codon_start=1
FT                   /gene_family="HOG000012638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636064"
FT                   /orf_name="MICPUN_56631"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62059.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199AC26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T6"
FT                   /transl_table=1
FT                   /translation="MVAEDAPPAVETEESPAPAEGAPAADDPPPSPPVEAEETPAPNPD
FT                   DDAPAPSGDSRVDGGVVARGPRTESHHDAGAGAEDLVDCTFVVLPERFEHSATIPATEP
FT                   FASVKSMLASALPIPLDAVMTLRQPDGGEPLPDDACLADYGVGAADEVDLELVVAYRTE
FT                   REMRAEAEENARREAEDFARLEEQAAAAAAAEAAQLAEESRLANTDAPSSLPETLRVTV
FT                   RGARRGEPSRVVTVRIDASGCVKPRYLGGFRDRRDGTVYHHASNQTIPTKPRVWKTKFT
FT                   TETQTAQGRSRLAQTTAQASTQMARKDLVMDESRDVEVWTGKYMTYDEVMVIKARHTLT
FT                   LQKYFRGMRARRLANELRAIRDDAVRRAEEEEAARAAAEERRRRFEIERRIRPKTSEDF
FT                   ELLYDELEQWRVRETAKVEAEFPPETDARRLAMSQLLAKETELIRTIGRLRIAANNANR
FT                   ERRVERALEDMSQTKRWERKDGSLVEVDTPFTVRARELARLYDALRLETRRDVSTDERL
FT                   DVLVHVKWTVKEFDCGLTREIVELADREADLLNRGRDPAAMTGLRRRIANLFLQFVETP
FT                   EFNPESARRTTD"
     MVAEDAPPAV ETEESPAPAE GAPAADDPPP SPPVEAEETP APNPDDDAPA PSGDSRVDGG        60
     VVARGPRTES HHDAGAGAED LVDCTFVVLP ERFEHSATIP ATEPFASVKS MLASALPIPL       120
     DAVMTLRQPD GGEPLPDDAC LADYGVGAAD EVDLELVVAY RTEREMRAEA EENARREAED       180
     FARLEEQAAA AAAAEAAQLA EESRLANTDA PSSLPETLRV TVRGARRGEP SRVVTVRIDA       240
     SGCVKPRYLG GFRDRRDGTV YHHASNQTIP TKPRVWKTKF TTETQTAQGR SRLAQTTAQA       300
     STQMARKDLV MDESRDVEVW TGKYMTYDEV MVIKARHTLT LQKYFRGMRA RRLANELRAI       360
     RDDAVRRAEE EEAARAAAEE RRRRFEIERR IRPKTSEDFE LLYDELEQWR VRETAKVEAE       420
     FPPETDARRL AMSQLLAKET ELIRTIGRLR IAANNANRER RVERALEDMS QTKRWERKDG       480
     SLVEVDTPFT VRARELARLY DALRLETRRD VSTDERLDVL VHVKWTVKEF DCGLTREIVE       540
     LADREADLLN RGRDPAAMTG LRRRIANLFL QFVETPEFNP ESARRTTD                    588
//

If you have problems or comments...

PBIL Back to PBIL home page