(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE6

MICSR_1.PE6          Location/Qualifiers
FT   CDS             complement(16396..17931)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636011"
FT                   /orf_name="MICPUN_99223"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62032.1"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniParc:UPI000199AA4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N3"
FT                   /transl_table=1
FT                   /translation="MVMVSQPTHPAFYEDDVRYHKCNVCAAEFNIPPPTRHELMQSFTG
FT                   AEIAALISEGCVIGSHRVFSDELERQMETMHPIQRLMTGYPHWIKGVYLIVDVREDNGR
FT                   ISLPVRTDASLDRVRQRFQAEAERSGYDGISLEVGGKKHTILAGVGSFKEVKDGDVEGI
FT                   KATLAALKAPAMLVLASETEPDCGEDSVTAVNMCRPVQLPPAAAQHLDALNERSNGADS
FT                   DLSTGIPDMMEWMEKFEDTEQFGSLDEAKNALRLEMHLAQYRATMDVMKKYPGVRRVKV
FT                   EHFIGGPCESDDIMWCVVPGGMKRGWTVVSRTLDSSEDESDESVKRAKSNVSTLVSAMM
FT                   LAHTRAVRRDDAQGDVCGGQTVRLRNLQARADLNGEVGLALRYDSESGRWMIRLRNGEG
FT                   KSVKPDNLEAMDGEGGRVFAFWGDARWSRAQLLGEIARGHWGLCRAGVGDITTSTAERW
FT                   ESLETSGRMAFAPVTEMTEDFMKNAHREMQVFRPSAAAAEGEDEGVQRDHSED"
     MVMVSQPTHP AFYEDDVRYH KCNVCAAEFN IPPPTRHELM QSFTGAEIAA LISEGCVIGS        60
     HRVFSDELER QMETMHPIQR LMTGYPHWIK GVYLIVDVRE DNGRISLPVR TDASLDRVRQ       120
     RFQAEAERSG YDGISLEVGG KKHTILAGVG SFKEVKDGDV EGIKATLAAL KAPAMLVLAS       180
     ETEPDCGEDS VTAVNMCRPV QLPPAAAQHL DALNERSNGA DSDLSTGIPD MMEWMEKFED       240
     TEQFGSLDEA KNALRLEMHL AQYRATMDVM KKYPGVRRVK VEHFIGGPCE SDDIMWCVVP       300
     GGMKRGWTVV SRTLDSSEDE SDESVKRAKS NVSTLVSAMM LAHTRAVRRD DAQGDVCGGQ       360
     TVRLRNLQAR ADLNGEVGLA LRYDSESGRW MIRLRNGEGK SVKPDNLEAM DGEGGRVFAF       420
     WGDARWSRAQ LLGEIARGHW GLCRAGVGDI TTSTAERWES LETSGRMAFA PVTEMTEDFM       480
     KNAHREMQVF RPSAAAAEGE DEGVQRDHSE D                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page