(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE60

MICSR_1.PE60         Location/Qualifiers
FT   CDS             join(113184..113276,113369..113572,113683..113746,
FT                   113880..114520)
FT                   /codon_start=1
FT                   /gene_family="HOG000256146" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636065"
FT                   /orf_name="MICPUN_80273"
FT                   /product="Predicted protein"
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="ACO61613.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI000199AC27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T7"
FT                   /transl_table=1
FT                   /translation="MAHTSGIGADVFDKGNWYHEVLEDGLAISYRVEEVLHKGQSKFQT
FT                   VEVVKTKPFGRLLITDGLMQSSEDDEYVYHQSLVHPALAGHPEPKKVFIAGGGEGATLR
FT                   EVLKHPSVEECKMVDIDGEVVDMCAKHTPFYNAGAYESPRAKLVIGDAKAGLEAEPDGS
FT                   IDVIICDLSDPLDGGPCYQLYTTSFYEMCKSKLAPGGILVTQSGCAAVRDCKAVFTPIN
FT                   KTLREVFPQVWGYTVCVPSFCSEWGFNIATKDADHVDLYTGITANGELDKRLAARGLGA
FT                   LSYYDGITHTRMFSLNRTVREACERETRVMTVENPLFMCSTDTHAGVFEPEK"
     MAHTSGIGAD VFDKGNWYHE VLEDGLAISY RVEEVLHKGQ SKFQTVEVVK TKPFGRLLIT        60
     DGLMQSSEDD EYVYHQSLVH PALAGHPEPK KVFIAGGGEG ATLREVLKHP SVEECKMVDI       120
     DGEVVDMCAK HTPFYNAGAY ESPRAKLVIG DAKAGLEAEP DGSIDVIICD LSDPLDGGPC       180
     YQLYTTSFYE MCKSKLAPGG ILVTQSGCAA VRDCKAVFTP INKTLREVFP QVWGYTVCVP       240
     SFCSEWGFNI ATKDADHVDL YTGITANGEL DKRLAARGLG ALSYYDGITH TRMFSLNRTV       300
     REACERETRV MTVENPLFMC STDTHAGVFE PEK                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page