(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE61

MICSR_1.PE61         Location/Qualifiers
FT   CDS             115061..117271
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636066"
FT                   /orf_name="MICPUN_56633"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61614.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000199AC28"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T8"
FT                   /transl_table=1
FT                   /translation="MADDEPPGDAVHTKGLWNRRRDLRCVRRHLGIGPDGDPDVEVRCA
FT                   RGDRVIAVGYRRVLLGDHGPYLELEREHVRWENLRLMPGGAARFYDEYRAIVDGESYDD
FT                   IAHSSIGTGGGGRGAKLYDQLKTVEGQGNPPRDSAWAVANNRPHEEGYAAYVVGKIYVG
FT                   AYDVAVRDPVVDADDVRRALPKPGGSGRVAWWKPARGVGAIVPDGVVGARNEGAGGGEE
FT                   EFATKEVSVTRDALAGGADTLAPGEGVWFDLESSGPSDRSVAVNVTGPGGEPVRQLCPG
FT                   AAAAAAEAARNGQKRSETARALRDGRRSAAALAAARARTVPWEARAEVERDAVAGAARR
FT                   IARILRDNCAAIAGLARIEGEGQRTLRACLRGWARWARKGSKSGEGDGSFGAGGVGRPS
FT                   TAPTLASPRRRDPPPGESPPPPRLNLTSAGRAKGLFAPVTRPPTPVASNPKTPRGPDEA
FT                   GDDPPAASVALPAWLTAVARGAVVCEVSHTRSSSAGDAAADAAGRVSKRCGFEARMPGL
FT                   EDSVRPVVVELTRDGVGALRTGAEGAEGADSGDRDPVAEAVARVDENLPVAEFGSSPLV
FT                   LVLPAGEEKASGSTVHPPRVPRLALRASKRVVGVVCVSSGPEQLVRDAVALAGACALGT
FT                   APFVPTEVFAAAGLDAAREWSRDDPRVASCVAVFERAGWGAARGMETGAGRDYCWRCGD
FT                   RSHRKRDCERVAGARPGENRPATTGGGGGRDVEAARVAELRL"
     MADDEPPGDA VHTKGLWNRR RDLRCVRRHL GIGPDGDPDV EVRCARGDRV IAVGYRRVLL        60
     GDHGPYLELE REHVRWENLR LMPGGAARFY DEYRAIVDGE SYDDIAHSSI GTGGGGRGAK       120
     LYDQLKTVEG QGNPPRDSAW AVANNRPHEE GYAAYVVGKI YVGAYDVAVR DPVVDADDVR       180
     RALPKPGGSG RVAWWKPARG VGAIVPDGVV GARNEGAGGG EEEFATKEVS VTRDALAGGA       240
     DTLAPGEGVW FDLESSGPSD RSVAVNVTGP GGEPVRQLCP GAAAAAAEAA RNGQKRSETA       300
     RALRDGRRSA AALAAARART VPWEARAEVE RDAVAGAARR IARILRDNCA AIAGLARIEG       360
     EGQRTLRACL RGWARWARKG SKSGEGDGSF GAGGVGRPST APTLASPRRR DPPPGESPPP       420
     PRLNLTSAGR AKGLFAPVTR PPTPVASNPK TPRGPDEAGD DPPAASVALP AWLTAVARGA       480
     VVCEVSHTRS SSAGDAAADA AGRVSKRCGF EARMPGLEDS VRPVVVELTR DGVGALRTGA       540
     EGAEGADSGD RDPVAEAVAR VDENLPVAEF GSSPLVLVLP AGEEKASGST VHPPRVPRLA       600
     LRASKRVVGV VCVSSGPEQL VRDAVALAGA CALGTAPFVP TEVFAAAGLD AAREWSRDDP       660
     RVASCVAVFE RAGWGAARGM ETGAGRDYCW RCGDRSHRKR DCERVAGARP GENRPATTGG       720
     GGGRDVEAAR VAELRL                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page