(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE62

MICSR_1.PE62         Location/Qualifiers
FT   CDS             join(complement(117465..118370),complement(117377..117391))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636067"
FT                   /orf_name="MICPUN_56634"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62060.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AC29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T9"
FT                   /transl_table=1
FT                   /translation="MSSSLLRPSLLAIASRHAMSSPTKAALGRKHASPARRSFDVTVSA
FT                   AASQNVDKKYVPGEPIANACVVVTGANRGIGLEFCKQILAKSPGNSVIASCRDPNAADD
FT                   LVALQKEVGESRLAVVALDVADETSIASWAQGLGALEPVQAHGGSIDVVINNAGTTGTD
FT                   GYSKWELEDMTADEMMHVYKINTVGPLLVTQQLVKRGLIGDPGSLNPVSLVGNVTSKVG
FT                   SVDDNGSGKGYAYRASKAALNIVNKSMSIDLADRGIWCQLLHPGWVRTRMTEGRGLIDA
FT                   DESARGLIRCVMFRETRLFPLGYGG"
     MSSSLLRPSL LAIASRHAMS SPTKAALGRK HASPARRSFD VTVSAAASQN VDKKYVPGEP        60
     IANACVVVTG ANRGIGLEFC KQILAKSPGN SVIASCRDPN AADDLVALQK EVGESRLAVV       120
     ALDVADETSI ASWAQGLGAL EPVQAHGGSI DVVINNAGTT GTDGYSKWEL EDMTADEMMH       180
     VYKINTVGPL LVTQQLVKRG LIGDPGSLNP VSLVGNVTSK VGSVDDNGSG KGYAYRASKA       240
     ALNIVNKSMS IDLADRGIWC QLLHPGWVRT RMTEGRGLID ADESARGLIR CVMFRETRLF       300
     PLGYGG                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page