(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE63

MICSR_1.PE63         Location/Qualifiers
FT   CDS             118548..122960
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636068"
FT                   /orf_name="MICPUN_56635"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61615.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199AC2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U0"
FT                   /transl_table=1
FT                   /translation="MEASEELDHAGTAPGATGAKETAAGGGDSPMNENVGPGAMGTSTA
FT                   QTEAAAPGSGGKSAGTPDLPQSEPRSLTADDDDDERSGAAGVTADARDDDAGAELPPSR
FT                   SPDDAPVAPTTTTPAGPSSGDPARSLADVLGKRPTPASDPKSSASAKPPAKKAARAKPS
FT                   TGPGITSFFGGGGKGGSGSDEDAPSRMPTRAEKLAADEAEEAAAIAAALAASEADEEDR
FT                   RAKAAAAAAATEAPTAVPVATEAPTAVPAEGAAAATASPVQDHEPDPTAAVVSASEAKK
FT                   THPLLVAAQRKKEKAAAEARAKAEAEARAKAEAEAKAKAEAEARAKAEAEARAKAEAEA
FT                   KAKAEAEAAAVAKAEADARAKAEEEERRRAAEDAALLADGSCEICGVDDDDGLLCDGCD
FT                   GVFHAKCVDLDSTPANEWFCARCAEHGVTNAGGGVAQRRAAKRKKANDEKRRANPFFMT
FT                   PDERRVAAEREAKQALMRDLEAVKQTDAALSTGKKVHHFFAMQKEKAAAAKESGASAAS
FT                   LNPLGLYVLPAPIERAMPPVHITPPIDPTVAEDEAVGRNALASVAGPPRKITRDGRFNP
FT                   SPDATLDSIRRALSPPAAVDTEEEQEEEDPGGEEGVDLEEAEDAYLTDAARYVLASEGR
FT                   WNAGAIVSGELASARGELRARLASLRARGAARAAGRDGSSSTDGSRLDRSTPSIGPAAA
FT                   AGALWTDAYAPAATDQLVCDGGAARGVRDWLDAWSSRIFAEEAGVVVKPPKDKEKAGNG
FT                   GRKGKRRKKGRGNAAASDDDTSDEECDEWDDESSGSLGTYAPLVTKRGGLPANGLLLCG
FT                   PVGSGKTSAVYAAAEEFGFKVLEVNPSRKRSGLEVLSQFGEATQSRRIGGGGDEQKKQG
FT                   AGGIGGFFGKKPAPAATTTSAPAKDTAKKDTAKETARNTLILFEEVDVLRGEDRGFMAA
FT                   LAQLIAGAKRPIVLTSNSPSLPSLIDAPLPAGTSGDGLRLARVRFRSPSPADAAVYASL
FT                   VAAAEGKRVSPGEVASAARLADAGDVRRALLSAQFAASSPAAEMTRRPTRGTTKSRSTA
FT                   AVAALEYDTNAVAAVAAELIARVDPRVAAAEALAPARALYAMSLVAEASQIEERETERR
FT                   AEEAAVRRRAEVVAAAAAAKAERAARNDARIEKGPLGSVGGRGGDRRGSLGLVAAGRSA
FT                   ANGDDEDGEEAERAAKVAAAADAARDAYLAEAAARFAERAPGGESPGGDSPETPPDAYP
FT                   GDDWARALRELDSLASLSASLSAADAMLNPARATVTGPSNGAAERVDVGGWLGGAGAAW
FT                   GDGGDGGWFDPSDDAEERGGADLAGEPRHTIGGGGDVAREASARIERLAVDACLGDRLV
FT                   DCRPPPRGGVGGGPPPAATGPASSVPKPAVSYGRVPAMGAAAARLRELAECTGATCARG
FT                   YGCGLGATGEANERAFFLARIVRIQEESASGVGAEGGRRRRKKASQYLQVGADVARELA
FT                   ALGTFGVTA"
     MEASEELDHA GTAPGATGAK ETAAGGGDSP MNENVGPGAM GTSTAQTEAA APGSGGKSAG        60
     TPDLPQSEPR SLTADDDDDE RSGAAGVTAD ARDDDAGAEL PPSRSPDDAP VAPTTTTPAG       120
     PSSGDPARSL ADVLGKRPTP ASDPKSSASA KPPAKKAARA KPSTGPGITS FFGGGGKGGS       180
     GSDEDAPSRM PTRAEKLAAD EAEEAAAIAA ALAASEADEE DRRAKAAAAA AATEAPTAVP       240
     VATEAPTAVP AEGAAAATAS PVQDHEPDPT AAVVSASEAK KTHPLLVAAQ RKKEKAAAEA       300
     RAKAEAEARA KAEAEAKAKA EAEARAKAEA EARAKAEAEA KAKAEAEAAA VAKAEADARA       360
     KAEEEERRRA AEDAALLADG SCEICGVDDD DGLLCDGCDG VFHAKCVDLD STPANEWFCA       420
     RCAEHGVTNA GGGVAQRRAA KRKKANDEKR RANPFFMTPD ERRVAAEREA KQALMRDLEA       480
     VKQTDAALST GKKVHHFFAM QKEKAAAAKE SGASAASLNP LGLYVLPAPI ERAMPPVHIT       540
     PPIDPTVAED EAVGRNALAS VAGPPRKITR DGRFNPSPDA TLDSIRRALS PPAAVDTEEE       600
     QEEEDPGGEE GVDLEEAEDA YLTDAARYVL ASEGRWNAGA IVSGELASAR GELRARLASL       660
     RARGAARAAG RDGSSSTDGS RLDRSTPSIG PAAAAGALWT DAYAPAATDQ LVCDGGAARG       720
     VRDWLDAWSS RIFAEEAGVV VKPPKDKEKA GNGGRKGKRR KKGRGNAAAS DDDTSDEECD       780
     EWDDESSGSL GTYAPLVTKR GGLPANGLLL CGPVGSGKTS AVYAAAEEFG FKVLEVNPSR       840
     KRSGLEVLSQ FGEATQSRRI GGGGDEQKKQ GAGGIGGFFG KKPAPAATTT SAPAKDTAKK       900
     DTAKETARNT LILFEEVDVL RGEDRGFMAA LAQLIAGAKR PIVLTSNSPS LPSLIDAPLP       960
     AGTSGDGLRL ARVRFRSPSP ADAAVYASLV AAAEGKRVSP GEVASAARLA DAGDVRRALL      1020
     SAQFAASSPA AEMTRRPTRG TTKSRSTAAV AALEYDTNAV AAVAAELIAR VDPRVAAAEA      1080
     LAPARALYAM SLVAEASQIE ERETERRAEE AAVRRRAEVV AAAAAAKAER AARNDARIEK      1140
     GPLGSVGGRG GDRRGSLGLV AAGRSAANGD DEDGEEAERA AKVAAAADAA RDAYLAEAAA      1200
     RFAERAPGGE SPGGDSPETP PDAYPGDDWA RALRELDSLA SLSASLSAAD AMLNPARATV      1260
     TGPSNGAAER VDVGGWLGGA GAAWGDGGDG GWFDPSDDAE ERGGADLAGE PRHTIGGGGD      1320
     VAREASARIE RLAVDACLGD RLVDCRPPPR GGVGGGPPPA ATGPASSVPK PAVSYGRVPA      1380
     MGAAAARLRE LAECTGATCA RGYGCGLGAT GEANERAFFL ARIVRIQEES ASGVGAEGGR      1440
     RRRKKASQYL QVGADVAREL AALGTFGVTA                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page