(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE64

MICSR_1.PE64         Location/Qualifiers
FT   CDS             complement(123029..123388)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636069"
FT                   /orf_name="MICPUN_56636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62061.1"
FT                   /db_xref="UniParc:UPI000199AC2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U1"
FT                   /transl_table=1
FT                   /translation="MSTTVTVIRKRPHCSATSVHEQEAIKLMPPPPPLLVPVMESEWER
FT                   KRRQSDIRRAENAFMEQQLRRERAEVERIACERTRIAMDNCERSELHAFLEELRVSGRV
FT                   SADEIVKRLACRVPA"
     MSTTVTVIRK RPHCSATSVH EQEAIKLMPP PPPLLVPVME SEWERKRRQS DIRRAENAFM        60
     EQQLRRERAE VERIACERTR IAMDNCERSE LHAFLEELRV SGRVSADEIV KRLACRVPA        119
//

If you have problems or comments...

PBIL Back to PBIL home page