(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE65

MICSR_1.PE65         Location/Qualifiers
FT   CDS             123994..125280
FT                   /codon_start=1
FT                   /gene_family="HOG000062589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636070"
FT                   /orf_name="MICPUN_56637"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61616.1"
FT                   /db_xref="HOGENOM:HBG485380"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199AC2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U2"
FT                   /transl_table=1
FT                   /translation="MVAIEEGLTRINSAPYEALLPRPDSPPLRKADPNKATVAKWSETA
FT                   DIFEYGAAANPDMAPIPVLVHPPSLHEEGETRIIPFDINDCLDIETACTSPNLMASFVR
FT                   VRVGESIETKANATSQAFYVIRGTGSTSSEHGTVSWGDGDLFVVPVTEGALKHTCVEAE
FT                   KGGAALYWIHDEPLMDYLGVKPNGKKFEPTFFSREKMLAQVQEISHQQTEGERNRLGVL
FT                   LGNKACDQTKTLTHVLWSLLNSIPAKTVQRPHRHNSVALDLAVAASPNVYTLMGKEIDA
FT                   NGDIIDPIRCDWTPGGVFITPPGWWHSHHNESDEVAWVLPMQDAGLYTHQRTLDIRFVD
FT                   DELELHKAGKIRGSAFAVTNKQYMHMVECGATVPHTRVAGMKRVWSLQEVEEEDPSSSG
FT                   DAAAPKKKTVKKVASYSRLPAMKASSVEP"
     MVAIEEGLTR INSAPYEALL PRPDSPPLRK ADPNKATVAK WSETADIFEY GAAANPDMAP        60
     IPVLVHPPSL HEEGETRIIP FDINDCLDIE TACTSPNLMA SFVRVRVGES IETKANATSQ       120
     AFYVIRGTGS TSSEHGTVSW GDGDLFVVPV TEGALKHTCV EAEKGGAALY WIHDEPLMDY       180
     LGVKPNGKKF EPTFFSREKM LAQVQEISHQ QTEGERNRLG VLLGNKACDQ TKTLTHVLWS       240
     LLNSIPAKTV QRPHRHNSVA LDLAVAASPN VYTLMGKEID ANGDIIDPIR CDWTPGGVFI       300
     TPPGWWHSHH NESDEVAWVL PMQDAGLYTH QRTLDIRFVD DELELHKAGK IRGSAFAVTN       360
     KQYMHMVECG ATVPHTRVAG MKRVWSLQEV EEEDPSSSGD AAAPKKKTVK KVASYSRLPA       420
     MKASSVEP                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page