(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE66

MICSR_1.PE66         Location/Qualifiers
FT   CDS             join(complement(127443..127501),complement(125420..127298))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636071"
FT                   /orf_name="MICPUN_56638"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62062.1"
FT                   /db_xref="UniParc:UPI000199AC2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U3"
FT                   /transl_table=1
FT                   /translation="MAAWEMTKEALRKVCRDNNGYAHAPELNDVLHLHCKGIAEITNLE
FT                   EYTGLKTLYLESNSVDDLEGLLHLDRLRCLYIAKNCLRDLDRAARLVALTTLDVSDNQI
FT                   VTLEGLRDHPSLSTLVAVNNKLREVSAIEALGSCVQLVTVDLSRNKLEDRAVVDFFLSP
FT                   AMSDRIRLLKLQGNPAVSEVPSYRKTLVSGMKRLNYLDDSPVFPKDKRLAAAWLRGGVE
FT                   EEKAERARIFEDERRERERHRAAFDDMVANARREAEEKERAGIRTKRDPYRFMSEEAAE
FT                   EARMLADGMTEWELEEMRANEQLPWQVRERERTLSEKTEADRAPNRAERPDEDDEDDEE
FT                   EGDGVAEVGPPEHVADDDGDERIPVAIPIDDDRPTPGIFVAQVDDDDDPAAPASAPPPP
FT                   PAPTSTTMTDEDREASEASAAEELRRELEKMRAARRGDRHEVVDGATRRRKELERAADS
FT                   ANRSGGRGSGSQRSPVVFGTRAYDQLWAQAKAMGDADGDNGEEVREDDEDSLDKESFKE
FT                   SFKDEDGVQNELDADGANSVNSESVDGTSNYSYGDKENRWERASMASVGATVASTEAGE
FT                   LDGIDEFDETEDETENTEDTEDTDEVNSTDGDDPLDRYTVSTVASGKETGKETGDDGRA
FT                   ANDDELWGLD"
     MAAWEMTKEA LRKVCRDNNG YAHAPELNDV LHLHCKGIAE ITNLEEYTGL KTLYLESNSV        60
     DDLEGLLHLD RLRCLYIAKN CLRDLDRAAR LVALTTLDVS DNQIVTLEGL RDHPSLSTLV       120
     AVNNKLREVS AIEALGSCVQ LVTVDLSRNK LEDRAVVDFF LSPAMSDRIR LLKLQGNPAV       180
     SEVPSYRKTL VSGMKRLNYL DDSPVFPKDK RLAAAWLRGG VEEEKAERAR IFEDERRERE       240
     RHRAAFDDMV ANARREAEEK ERAGIRTKRD PYRFMSEEAA EEARMLADGM TEWELEEMRA       300
     NEQLPWQVRE RERTLSEKTE ADRAPNRAER PDEDDEDDEE EGDGVAEVGP PEHVADDDGD       360
     ERIPVAIPID DDRPTPGIFV AQVDDDDDPA APASAPPPPP APTSTTMTDE DREASEASAA       420
     EELRRELEKM RAARRGDRHE VVDGATRRRK ELERAADSAN RSGGRGSGSQ RSPVVFGTRA       480
     YDQLWAQAKA MGDADGDNGE EVREDDEDSL DKESFKESFK DEDGVQNELD ADGANSVNSE       540
     SVDGTSNYSY GDKENRWERA SMASVGATVA STEAGELDGI DEFDETEDET ENTEDTEDTD       600
     EVNSTDGDDP LDRYTVSTVA SGKETGKETG DDGRAANDDE LWGLD                       645
//

If you have problems or comments...

PBIL Back to PBIL home page