(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE68

MICSR_1.PE68         Location/Qualifiers
FT   CDS             complement(129992..130489)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636073"
FT                   /orf_name="MICPUN_56640"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62063.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AC2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U5"
FT                   /transl_table=1
FT                   /translation="MKLLDALSGRVTRSARFREYVDQSFAEVDHNANGSLDRAELHLAV
FT                   MLFFDKLNAKVKKRAIPPTKAELMALFDEVDTDESGELSLEEFVAYMERLCAQCTSGLT
FT                   VSLLKSFIAVPFTAIALSVGIKKVAPGMHQKIKEAKGLGSATLSFCASQIVNKVPAFAA
FT                   VP"
     MKLLDALSGR VTRSARFREY VDQSFAEVDH NANGSLDRAE LHLAVMLFFD KLNAKVKKRA        60
     IPPTKAELMA LFDEVDTDES GELSLEEFVA YMERLCAQCT SGLTVSLLKS FIAVPFTAIA       120
     LSVGIKKVAP GMHQKIKEAK GLGSATLSFC ASQIVNKVPA FAAVP                       165
//

If you have problems or comments...

PBIL Back to PBIL home page