(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE69

MICSR_1.PE69         Location/Qualifiers
FT   CDS             complement(130670..132871)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636074"
FT                   /orf_name="MICPUN_56641"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62064.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AC30"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U6"
FT                   /transl_table=1
FT                   /translation="MAAPDAPDESTSRMGPYDVLEQIGKGAFGAAWIIQTRGNDSNPPR
FT                   RFVLKKIPLARLSERQRHLSLQERQLVAALRHPYIVPYHRSWIERSHTVCIVMRHCDGG
FT                   DLASAAWRARRRRERFPEQTLRRWLAQLLSALAYLHSERVIHRDVKCGNVFLASPPGFE
FT                   PGTSHAPTNSTNSWGDVMLGDFGLARVVDANAADDVQATSTVGTPHFMSPEMLRGAKYG
FT                   FAADVWSLGCVMYELTTLRQPFTAFNMEGLRRKILTSPPAAFIQPGKEGEEDASLYGDG
FT                   WRATIRSMLRKAPEERPSASELLRTSDMADAAADADARAREIEAAAAAERREEGRGEEG
FT                   GEDGRGDGAGDAAFLAAPDREPMPAPGGDWSPSADERSQPPGRSSVRRGWADLDPSYMR
FT                   FNPQRKPRPPPRPQSARPARASTGAPRNPDTETGQKQRAAATPATQKTAQKTAGRRPGW
FT                   NASPRVRPASGGPLGRPASAPRTPSSGDRAAARRASGVVVTGRAVTGRAVTGRAASGGG
FT                   ADGSDGFDPYAPVAAEPASALAPKHPADENEAPNNTDETPSKSRDEAPSWTRDEAPSRD
FT                   DVVARARRLLAETSPKLAAPSPIARHDGTDDDADDSRVLRAVAALHARGRHAELARVLS
FT                   NFYPPAEAIPPTPSAPDLEPGQCVMVGASSPTRGTIRYVGAVAFAEGEWVGVEMDDEGV
FT                   GAVTGRAVTGRDGRVGAIQYFACRPGRGVFVPAATLTRA"
     MAAPDAPDES TSRMGPYDVL EQIGKGAFGA AWIIQTRGND SNPPRRFVLK KIPLARLSER        60
     QRHLSLQERQ LVAALRHPYI VPYHRSWIER SHTVCIVMRH CDGGDLASAA WRARRRRERF       120
     PEQTLRRWLA QLLSALAYLH SERVIHRDVK CGNVFLASPP GFEPGTSHAP TNSTNSWGDV       180
     MLGDFGLARV VDANAADDVQ ATSTVGTPHF MSPEMLRGAK YGFAADVWSL GCVMYELTTL       240
     RQPFTAFNME GLRRKILTSP PAAFIQPGKE GEEDASLYGD GWRATIRSML RKAPEERPSA       300
     SELLRTSDMA DAAADADARA REIEAAAAAE RREEGRGEEG GEDGRGDGAG DAAFLAAPDR       360
     EPMPAPGGDW SPSADERSQP PGRSSVRRGW ADLDPSYMRF NPQRKPRPPP RPQSARPARA       420
     STGAPRNPDT ETGQKQRAAA TPATQKTAQK TAGRRPGWNA SPRVRPASGG PLGRPASAPR       480
     TPSSGDRAAA RRASGVVVTG RAVTGRAVTG RAASGGGADG SDGFDPYAPV AAEPASALAP       540
     KHPADENEAP NNTDETPSKS RDEAPSWTRD EAPSRDDVVA RARRLLAETS PKLAAPSPIA       600
     RHDGTDDDAD DSRVLRAVAA LHARGRHAEL ARVLSNFYPP AEAIPPTPSA PDLEPGQCVM       660
     VGASSPTRGT IRYVGAVAFA EGEWVGVEMD DEGVGAVTGR AVTGRDGRVG AIQYFACRPG       720
     RGVFVPAATL TRA                                                          733
//

If you have problems or comments...

PBIL Back to PBIL home page