(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE7

MICSR_1.PE7          Location/Qualifiers
FT   CDS             18257..19363
FT                   /codon_start=1
FT                   /gene_family="HOG000243720" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636012"
FT                   /orf_name="MICPUN_79463"
FT                   /product="GHMP kinase"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61587.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG316421"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AA4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N4"
FT                   /transl_table=1
FT                   /translation="MTVGHICPDATDDITHRAYARVGLLGNPSDGYFGKCISVSVQNFF
FT                   AEVTLTPNQQMFSSRVTIEPGPSDSTVFESLETLAVTTAKSGYYGGVRLLRALCFKFQE
FT                   YCAERGYDLAERGFTLEYESNIPTQAGLSGSSAIIVAGLKCLMQHYSVYIPLEEQPALV
FT                   LSCEHDLGINAGLQDRVIQCYEGVVYMDFSNEEMVRTQGKGVYTRLPETCLPPLHIVYD
FT                   DNPSDSGKVHADVKQRWERGDADVRSKMSRIAELAERGYKVLSSIGTDKQTGEPMIELG
FT                   MLMNANFNLRKEMFGAEALGARNVEMIDTARGTGSFAKFTGSGGAAVVLCPTNSEEERE
FT                   AMYADCEAKGFKVCPLVVNPGKPSGGAA"
     MTVGHICPDA TDDITHRAYA RVGLLGNPSD GYFGKCISVS VQNFFAEVTL TPNQQMFSSR        60
     VTIEPGPSDS TVFESLETLA VTTAKSGYYG GVRLLRALCF KFQEYCAERG YDLAERGFTL       120
     EYESNIPTQA GLSGSSAIIV AGLKCLMQHY SVYIPLEEQP ALVLSCEHDL GINAGLQDRV       180
     IQCYEGVVYM DFSNEEMVRT QGKGVYTRLP ETCLPPLHIV YDDNPSDSGK VHADVKQRWE       240
     RGDADVRSKM SRIAELAERG YKVLSSIGTD KQTGEPMIEL GMLMNANFNL RKEMFGAEAL       300
     GARNVEMIDT ARGTGSFAKF TGSGGAAVVL CPTNSEEERE AMYADCEAKG FKVCPLVVNP       360
     GKPSGGAA                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page