(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE70

MICSR_1.PE70         Location/Qualifiers
FT   CDS             complement(133147..134469)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636075"
FT                   /orf_name="MICPUN_56642"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62065.1"
FT                   /db_xref="UniParc:UPI000199AC9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U7"
FT                   /transl_table=1
FT                   /translation="MRGSASRTVAWAALARSATIDPARIIASAARASAPAHRREDASRS
FT                   RGRWIERRRRHEHPRFSTVGEAFLVAAHAEVLRRAGAEVPANLAQLLAVVTAEGASPLP
FT                   PDARDGLHPLVLPIAKAWRGDRDDDRVVGLLLRPSPSSPRAPLAGPLPVVLAGPGGVRM
FT                   LAKDAASYVHAAIIREDASPASATTTPEPYPVAGAAGAAGRAMYTRGELAASSMPDRPE
FT                   VFILRNVGKFPDDMEAMALRHLRGVEKEGASPSQSAVTSALVTAEWYANDRAFEGWAGP
FT                   QAFNARMLFAMGRADEARDAARVALSTAACWDTVGTERGGAAEMAALAGLDARMGAREL
FT                   REMLETGGEAHKAAAAAMAGRIPENVGASGGPRGEGGMSEETSRGYATRAAAAALDAVA
FT                   LGSEADVARGAGESWENAREEVGSAYGEAGLAGLAAFVLRR"
     MRGSASRTVA WAALARSATI DPARIIASAA RASAPAHRRE DASRSRGRWI ERRRRHEHPR        60
     FSTVGEAFLV AAHAEVLRRA GAEVPANLAQ LLAVVTAEGA SPLPPDARDG LHPLVLPIAK       120
     AWRGDRDDDR VVGLLLRPSP SSPRAPLAGP LPVVLAGPGG VRMLAKDAAS YVHAAIIRED       180
     ASPASATTTP EPYPVAGAAG AAGRAMYTRG ELAASSMPDR PEVFILRNVG KFPDDMEAMA       240
     LRHLRGVEKE GASPSQSAVT SALVTAEWYA NDRAFEGWAG PQAFNARMLF AMGRADEARD       300
     AARVALSTAA CWDTVGTERG GAAEMAALAG LDARMGAREL REMLETGGEA HKAAAAAMAG       360
     RIPENVGASG GPRGEGGMSE ETSRGYATRA AAAALDAVAL GSEADVARGA GESWENAREE       420
     VGSAYGEAGL AGLAAFVLRR                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page