(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE71

MICSR_1.PE71         Location/Qualifiers
FT   CDS             134554..135915
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636076"
FT                   /orf_name="MICPUN_56643"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61618.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AC9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U8"
FT                   /transl_table=1
FT                   /translation="MPSSSPSSSSSSGGTSAKRRRAKYERKFLRAAARGSLRGCKKALK
FT                   RASSRGSGVDAGFLDVTSASDPDGRTALHLACASGDDDLARWLIKRGADVTSTDARGDT
FT                   PAHLAAHRAPDNVAITRRLTRAGASTHARNDAGETPSSIAERAAESRAARMREFDARRE
FT                   ARTRRGRDADDYEGLGRGPSREAIEEMEWREKLRAEAALGDAIDEFGGGTAGIGTADEM
FT                   NAFYASYVDDWDDGSAYAWREEEEAYAEYMRAGMAARRRKRLDDDNDDDDPRRRRRDSA
FT                   AEAQARATRERDEAAQRVLDEERRKDAEWRERTARRATQQASSSVSSSVFTDFATYRRR
FT                   WGIAAAKADRGESIAYADVPWPFDPESRRGEPDERVVRDVLLGPTGAGAVEEGSGSDAA
FT                   RRALRSEMLRWHPDKFFASKVGSRVASEDVERTRLGVNAVAGVIASLFRRSAGS"
     MPSSSPSSSS SSGGTSAKRR RAKYERKFLR AAARGSLRGC KKALKRASSR GSGVDAGFLD        60
     VTSASDPDGR TALHLACASG DDDLARWLIK RGADVTSTDA RGDTPAHLAA HRAPDNVAIT       120
     RRLTRAGAST HARNDAGETP SSIAERAAES RAARMREFDA RREARTRRGR DADDYEGLGR       180
     GPSREAIEEM EWREKLRAEA ALGDAIDEFG GGTAGIGTAD EMNAFYASYV DDWDDGSAYA       240
     WREEEEAYAE YMRAGMAARR RKRLDDDNDD DDPRRRRRDS AAEAQARATR ERDEAAQRVL       300
     DEERRKDAEW RERTARRATQ QASSSVSSSV FTDFATYRRR WGIAAAKADR GESIAYADVP       360
     WPFDPESRRG EPDERVVRDV LLGPTGAGAV EEGSGSDAAR RALRSEMLRW HPDKFFASKV       420
     GSRVASEDVE RTRLGVNAVA GVIASLFRRS AGS                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page