(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE72

MICSR_1.PE72         Location/Qualifiers
FT   CDS             complement(136036..136548)
FT                   /codon_start=1
FT                   /gene_family="HOG000100018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636077"
FT                   /orf_name="MICPUN_56644"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62066.1"
FT                   /db_xref="UniParc:UPI000199ACA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U9"
FT                   /transl_table=1
FT                   /translation="MAPPRIPGGRGGGRGRGKGGYKGRMGKNFRKNPDGSDKPKGKARR
FT                   SGLGLWGIGLVTGAIAGLVALVAHGERAALERESEAVRRRLRRKPRGFSEHAVCRMDCR
FT                   FIGEDEATATLARGKLSKRHSTPGATPCPRWALEDGRVRAVWAECRDETKLVTVIDTVT
FT                   DHPCGPC"
     MAPPRIPGGR GGGRGRGKGG YKGRMGKNFR KNPDGSDKPK GKARRSGLGL WGIGLVTGAI        60
     AGLVALVAHG ERAALERESE AVRRRLRRKP RGFSEHAVCR MDCRFIGEDE ATATLARGKL       120
     SKRHSTPGAT PCPRWALEDG RVRAVWAECR DETKLVTVID TVTDHPCGPC                  170
//

If you have problems or comments...

PBIL Back to PBIL home page