(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE73

MICSR_1.PE73         Location/Qualifiers
FT   CDS             136695..137873
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636078"
FT                   /orf_name="MICPUN_56645"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61619.1"
FT                   /db_xref="UniParc:UPI000199ACA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V0"
FT                   /transl_table=1
FT                   /translation="MARGTLRTTPRRANRPVGDEEAATRKMGAMGTGGVSVNARLNLEA
FT                   VERTLAALSGGKENDALGLDTVLVKGLHDMAIDEAIARAGRKASARAGKGIVHNRKGPT
FT                   VSVPDAVKTPAAVRAIVAKALAGKVLSRREQDRLRDELERREGAVPGKPPASSPFTPPP
FT                   PPVNTPVGLARRYPAMTCGDTNESADADASPPFAMTPTLLAEAARLAMRNVGTGKGPSN
FT                   PLGRALAAGERGEPLTSTQRNILDAVEELRAGKIIPDDRMRLLEWAQTDDDDVAVAKGS
FT                   RPMTSPSTVASLCAATFGILPLTPPSDADEDAASSYASDEVFSFDQGKIAGENRVEETS
FT                   PEPWISPVEFNRGKSMTPTLEELARRKEGGEALTEGEDAMVSIFKLASPVAR"
     MARGTLRTTP RRANRPVGDE EAATRKMGAM GTGGVSVNAR LNLEAVERTL AALSGGKEND        60
     ALGLDTVLVK GLHDMAIDEA IARAGRKASA RAGKGIVHNR KGPTVSVPDA VKTPAAVRAI       120
     VAKALAGKVL SRREQDRLRD ELERREGAVP GKPPASSPFT PPPPPVNTPV GLARRYPAMT       180
     CGDTNESADA DASPPFAMTP TLLAEAARLA MRNVGTGKGP SNPLGRALAA GERGEPLTST       240
     QRNILDAVEE LRAGKIIPDD RMRLLEWAQT DDDDVAVAKG SRPMTSPSTV ASLCAATFGI       300
     LPLTPPSDAD EDAASSYASD EVFSFDQGKI AGENRVEETS PEPWISPVEF NRGKSMTPTL       360
     EELARRKEGG EALTEGEDAM VSIFKLASPV AR                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page